Q97Y68 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97Y68 - Transposase, putative

UniProt:	Q97Y68	Sequences: MELKSTRHTKYLCNYHFVWIPKHRRNTLVNEIAEYTKEVLKSIAEELGCEIIALEVMPDHIHLFVNCPPRYAPSYLANYFKGKSARLILKKFPQLNKGKLWTRSYFVATAGNVSSEVIKKYIEEQWRKEGEEE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	133 (121)
Sequences:	1753 (1171)
Seq/√Len:	106.4

HALSA - Q9HHX7 Q9HSW8 Q9HM86 Q9HSD5
SULSO - Q97Y68

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
35_Y	91_K	4.743	1.00
33_A	126_W	2.653	1.00
40_L	80_F	2.604	1.00
35_Y	92_F	2.565	1.00
15_Y	67_C	2.316	1.00
53_A	123_E	2.295	1.00
39_V	84_S	2.176	1.00
17_F	77_A	2.119	1.00
40_L	84_S	2.012	1.00
15_Y	109_T	1.999	1.00
64_F	122_I	1.930	1.00
49_C	76_L	1.918	1.00
67_C	73_P	1.882	1.00
17_F	65_V	1.833	1.00
47_L	79_Y	1.798	1.00
11_Y	107_V	1.751	1.00
120_K	124_E	1.747	1.00
20_I	102_T	1.695	1.00
87_L	90_K	1.675	1.00
35_Y	38_E	1.670	1.00
89_L	98_G	1.607	1.00
75_Y	78_N	1.568	1.00
120_K	123_E	1.555	1.00
86_R	90_K	1.508	1.00
115_S	119_K	1.503	1.00
20_I	24_R	1.449	1.00
13_C	67_C	1.444	1.00
35_Y	39_V	1.422	1.00
85_A	89_L	1.397	1.00
64_F	115_S	1.367	1.00
36_T	88_I	1.334	0.99
37_K	41_K	1.332	0.99
44_A	51_I	1.332	0.99
119_K	123_E	1.331	0.99
65_V	76_L	1.330	0.99
28_L	36_T	1.328	0.99
43_I	47_L	1.326	0.99
124_E	127_R	1.319	0.99
48_G	70_R	1.318	0.99
33_A	37_K	1.293	0.99
28_L	100_L	1.292	0.99
43_I	83_K	1.260	0.99
73_P	77_A	1.240	0.99
32_I	94_Q	1.231	0.99
50_E	66_N	1.220	0.99
68_P	71_Y	1.212	0.99
13_C	107_V	1.208	0.99
116_E	119_K	1.195	0.99
15_Y	73_P	1.194	0.99
41_K	45_E	1.186	0.99
39_V	83_K	1.177	0.99
44_A	80_F	1.156	0.98
114_S	117_V	1.155	0.98
67_C	76_L	1.155	0.98
39_V	87_L	1.139	0.98
110_A	115_S	1.136	0.98
17_F	73_P	1.118	0.98
73_P	107_V	1.109	0.98
44_A	49_C	1.078	0.98
14_N	110_A	1.049	0.97
37_K	56_V	1.028	0.97
15_Y	107_V	1.012	0.96
44_A	63_L	1.010	0.96
40_L	54_L	1.003	0.96
72_A	75_Y	0.999	0.96
42_S	46_E	0.981	0.96
13_C	73_P	0.967	0.95
53_A	119_K	0.963	0.95
39_V	43_I	0.959	0.95
11_Y	66_N	0.949	0.95
16_H	110_A	0.946	0.95
37_K	55_E	0.943	0.95
56_V	61_I	0.942	0.95
17_F	107_V	0.936	0.95
74_S	105_Y	0.935	0.94
14_N	52_I	0.933	0.94
44_A	76_L	0.920	0.94
71_Y	76_L	0.915	0.94
79_Y	82_G	0.907	0.94
111_G	114_S	0.903	0.93
79_Y	83_K	0.902	0.93
37_K	54_L	0.881	0.93
69_P	74_S	0.880	0.92
64_F	110_A	0.871	0.92
12_L	108_A	0.869	0.92
55_E	126_W	0.862	0.92
32_I	88_I	0.856	0.91
85_A	98_G	0.850	0.91
40_L	61_I	0.849	0.91
95_L	98_G	0.846	0.91
40_L	63_L	0.842	0.91
89_L	99_K	0.841	0.91
14_N	66_N	0.841	0.91
26_N	59_D	0.841	0.91
117_V	120_K	0.829	0.90
28_L	88_I	0.814	0.89
19_W	65_V	0.811	0.89
36_T	40_L	0.801	0.88
49_C	71_Y	0.800	0.88
30_N	126_W	0.796	0.88
39_V	42_S	0.789	0.88
43_I	79_Y	0.785	0.87
38_E	45_E	0.782	0.87
38_E	88_I	0.773	0.87
65_V	107_V	0.770	0.86
42_S	45_E	0.765	0.86
31_E	35_Y	0.764	0.86
29_V	94_Q	0.764	0.86
33_A	57_M	0.763	0.86
35_Y	88_I	0.763	0.86
51_I	65_V	0.758	0.86
85_A	99_K	0.755	0.85
89_L	96_N	0.748	0.85
9_T	13_C	0.741	0.84
57_M	126_W	0.730	0.83
12_L	66_N	0.725	0.83
75_Y	79_Y	0.717	0.82
38_E	42_S	0.706	0.81
78_N	103_R	0.706	0.81
72_A	77_A	0.705	0.81
33_A	55_E	0.703	0.81
65_V	73_P	0.702	0.81
78_N	82_G	0.692	0.80
33_A	56_V	0.681	0.79
28_L	32_I	0.677	0.79
44_A	82_G	0.672	0.78
11_Y	15_Y	0.656	0.76
88_I	91_K	0.654	0.76
53_A	61_I	0.634	0.74
28_L	33_A	0.629	0.73
11_Y	69_P	0.628	0.73
30_N	34_E	0.625	0.73
122_I	125_Q	0.621	0.72
41_K	51_I	0.619	0.72
88_I	95_L	0.618	0.72
68_P	74_S	0.618	0.72
82_G	89_L	0.615	0.72
14_N	115_S	0.614	0.72
116_E	120_K	0.614	0.72
37_K	57_M	0.613	0.71
52_I	66_N	0.611	0.71
33_A	54_L	0.602	0.70
48_G	96_N	0.602	0.70
16_H	62_H	0.599	0.70
28_L	56_V	0.594	0.69
38_E	91_K	0.583	0.68
16_H	60_H	0.582	0.67
47_L	83_K	0.581	0.67
93_P	96_N	0.580	0.67
34_E	41_K	0.570	0.66
82_G	85_A	0.569	0.66
45_E	48_G	0.567	0.65
113_V	118_I	0.561	0.65
13_C	109_T	0.561	0.65
29_V	33_A	0.555	0.64
42_S	87_L	0.555	0.64
68_P	72_A	0.554	0.64
40_L	51_I	0.554	0.64
12_L	122_I	0.553	0.64
65_V	71_Y	0.549	0.63
24_R	121_Y	0.549	0.63
7_R	104_S	0.549	0.63
31_E	94_Q	0.548	0.63
8_H	103_R	0.548	0.63
44_A	65_V	0.547	0.63
31_E	34_E	0.540	0.62
34_E	45_E	0.539	0.62
12_L	106_F	0.538	0.61
82_G	86_R	0.534	0.61
83_K	87_L	0.531	0.60
32_I	95_L	0.529	0.60
46_E	83_K	0.529	0.60
10_K	104_S	0.529	0.60
36_T	105_Y	0.522	0.59
48_G	75_Y	0.520	0.59
14_N	64_F	0.518	0.59
93_P	99_K	0.515	0.58
20_I	55_E	0.515	0.58
57_M	125_Q	0.515	0.58
108_A	114_S	0.513	0.58
114_S	122_I	0.509	0.57
71_Y	109_T	0.500	0.56

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2f5gA	2	0.9774	100	0.316	Contact Map
2vjvA	2	0.9173	100	0.333	Contact Map
2fyxA	2	0.9398	100	0.375	Contact Map
4er8A	1	0.9398	99.9	0.493	Contact Map
4nrdA	3	0.5489	8.3	0.947	Contact Map
2x3gA	2	0.8346	7.8	0.947	Contact Map
4m8kA	2	0.5639	6.4	0.949	Contact Map
2kvvA	1	0.5038	5.3	0.951	Contact Map
2yxoA	3	0.5113	5	0.952	Contact Map
3i4sA	2	0.7744	3.9	0.954	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0069 seconds.