Q97Y49 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97Y49 - First ORF in transposon ISC1904

UniProt:	Q97Y49	Sequences: MGIIRKRKVILYARVPSSTQKDELVNQVKYLEEQVKEYDQVISDIGSGLNMKRKGFLKLLRMILNNEVSRVVVAYPDRLVRLRNLRGSVQSTQLRNSSTKPEGQNTRTGDD	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	111 (97)
Sequences:	480 (298)
Seq/√Len:	30.2

SULSO - Q97Y49 Q97Z60 Q97YI6 Q97XB5 Q97YH2 Q97YX0 Q97XI0 Q97YU0 Q97U67 Q97U52 Q97UQ9 Q97X40 Q97XQ1 Q97XZ4 Q7LXE3 Q97X25 Q97WZ6

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
13_A	31_L	3.423	1.00
9_V	70_R	3.228	1.00
35_V	72_V	2.862	1.00
44_D	55_G	2.861	1.00
56_F	79_L	2.706	1.00
70_R	100_K	2.690	1.00
30_Y	74_A	2.538	0.99
28_V	41_V	2.220	0.99
11_L	31_L	2.187	0.98
64_L	97_S	2.108	0.98
63_I	94_L	2.081	0.98
51_M	85_L	1.993	0.97
11_L	104_Q	1.961	0.97
40_Q	62_M	1.898	0.96
42_I	55_G	1.885	0.96
91_S	95_R	1.806	0.95
49_L	82_L	1.694	0.93
80_V	84_N	1.669	0.92
94_L	99_T	1.611	0.91
84_N	103_G	1.606	0.91
28_V	43_S	1.555	0.89
72_V	102_E	1.553	0.89
59_L	68_V	1.496	0.87
34_Q	39_D	1.487	0.87
8_K	62_M	1.486	0.87
63_I	71_V	1.470	0.86
51_M	80_V	1.429	0.85
34_Q	38_Y	1.419	0.84
84_N	101_P	1.349	0.81
72_V	85_L	1.327	0.80
25_V	29_K	1.315	0.79
61_R	96_N	1.246	0.75
63_I	68_V	1.208	0.73
62_M	67_E	1.204	0.73
38_Y	102_E	1.179	0.71
11_L	41_V	1.179	0.71
9_V	72_V	1.136	0.68
49_L	83_R	1.127	0.68
11_L	35_V	1.125	0.67
23_E	74_A	1.084	0.65
53_R	80_V	1.058	0.63
10_I	59_L	1.054	0.62
31_L	104_Q	1.042	0.61
10_I	28_V	1.039	0.61
80_V	90_Q	1.034	0.61
7_R	65_N	1.026	0.60
60_L	64_L	1.013	0.59
44_D	74_A	1.007	0.59
36_K	39_D	0.990	0.57
37_E	72_V	0.989	0.57
29_K	32_E	0.978	0.56
7_R	99_T	0.978	0.56
63_I	73_V	0.976	0.56
73_V	100_K	0.969	0.56
12_Y	15_V	0.965	0.55
9_V	100_K	0.928	0.53
48_G	79_L	0.912	0.51
56_F	80_V	0.912	0.51
63_I	99_T	0.883	0.49
84_N	90_Q	0.871	0.48
9_V	40_Q	0.852	0.46
26_N	29_K	0.851	0.46
10_I	68_V	0.838	0.45
20_Q	23_E	0.826	0.44
19_T	74_A	0.821	0.44
29_K	33_E	0.818	0.44
30_Y	105_N	0.811	0.43
34_Q	102_E	0.798	0.42
60_L	89_V	0.779	0.41
56_F	89_V	0.776	0.41
11_L	89_V	0.772	0.40
23_E	26_N	0.771	0.40
61_R	92_T	0.769	0.40
22_D	58_K	0.763	0.40
93_Q	97_S	0.758	0.39
30_Y	44_D	0.746	0.38
48_G	56_F	0.737	0.38
70_R	102_E	0.734	0.37
18_S	66_N	0.730	0.37
25_V	28_V	0.727	0.37
16_P	20_Q	0.721	0.36
17_S	42_I	0.712	0.36
35_V	39_D	0.703	0.35
15_V	20_Q	0.701	0.35
17_S	26_N	0.700	0.35
34_Q	70_R	0.695	0.34
20_Q	54_K	0.686	0.34
8_K	40_Q	0.683	0.34
64_L	89_V	0.675	0.33
54_K	97_S	0.672	0.33
35_V	74_A	0.668	0.33
76_P	85_L	0.667	0.32
71_V	101_P	0.666	0.32
72_V	92_T	0.665	0.32
42_I	59_L	0.655	0.32
25_V	33_E	0.651	0.31
25_V	41_V	0.645	0.31
32_E	59_L	0.640	0.31
11_L	105_N	0.637	0.30
57_L	92_T	0.635	0.30
76_P	103_G	0.631	0.30
18_S	21_K	0.626	0.30
16_P	82_L	0.625	0.30
11_L	53_R	0.624	0.30
46_G	100_K	0.624	0.30
19_T	75_Y	0.623	0.29
91_S	101_P	0.623	0.29
42_I	71_V	0.621	0.29
45_I	53_R	0.617	0.29
80_V	89_V	0.617	0.29
55_G	73_V	0.615	0.29
31_L	99_T	0.613	0.29
18_S	48_G	0.608	0.28
49_L	89_V	0.608	0.28
9_V	46_G	0.594	0.28
64_L	93_Q	0.587	0.27
26_N	56_F	0.584	0.27
18_S	45_I	0.579	0.27
27_Q	78_R	0.573	0.26
54_K	69_S	0.569	0.26
17_S	46_G	0.569	0.26
17_S	54_K	0.557	0.25
9_V	69_S	0.550	0.25
76_P	100_K	0.546	0.25
32_E	41_V	0.545	0.25
33_E	37_E	0.541	0.24
17_S	20_Q	0.536	0.24
23_E	49_L	0.535	0.24
8_K	95_R	0.534	0.24
53_R	74_A	0.529	0.24
30_Y	106_T	0.528	0.24
90_Q	94_L	0.526	0.23
37_E	76_P	0.526	0.23
44_D	101_P	0.523	0.23
10_I	39_D	0.522	0.23
19_T	22_D	0.515	0.23
33_E	65_N	0.515	0.23
18_S	92_T	0.514	0.23
41_V	64_L	0.514	0.23
43_S	95_R	0.512	0.23
92_T	104_Q	0.507	0.22
17_S	73_V	0.506	0.22
50_N	97_S	0.506	0.22
93_Q	105_N	0.503	0.22
84_N	91_S	0.502	0.22
52_K	97_S	0.500	0.22

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3lhkA	2	0.9279	99.9	0.53	Contact Map
3ilxA	2	0.9099	99.8	0.551	Contact Map
3bvpA	4	0.9459	99.8	0.58	Contact Map
2mhcA	1	0.991	99.8	0.582	Contact Map
3guvA	2	0.9279	99.8	0.587	Contact Map
3g13A	2	0.955	99.8	0.589	Contact Map
4bqqA	2	0.9099	99.7	0.604	Contact Map
2gm5A	4	0.8468	99.7	0.628	Contact Map
3pkzA	4	0.8559	99.7	0.63	Contact Map
1gdtA	2	0.9009	99.6	0.643	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0061 seconds.