Q97Y19 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97Y19 - Dihydrolipoamide S-acetyltransferase, carboxy-end (PdhC)

UniProt:	Q97Y19	Sequences: MKITYTDILVKVVAKLLRDHPYLNATLEGDQIKIIEEVNIGIAVALDQGLIVPVIRNADTKPITEIAKESHELADKARENKLNPDEVSGGTFTISNLGMYDIDSFTPIINPPQTAILGVGRIRRAPVVVGDNISIGYIMWLSLTFDHRVMDGHTAAKFLKELTEILEDENKLRTFLS	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	177 (171)
Sequences:	6159 (3101)
Seq/√Len:	237.1

ECOLI - ODO2 ODP2
BACSU - ACOC ODB2 ODP2 ODO2
HALSA - Q9HN75
SULSO - Q97Y19

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
19_D	161_E	3.316	1.00
61_K	69_E	3.245	1.00
72_E	76_K	3.099	1.00
128_V	135_I	2.821	1.00
26_T	35_I	2.722	1.00
75_D	79_E	2.684	1.00
20_H	161_E	2.629	1.00
124_R	131_D	2.601	1.00
76_K	86_E	2.487	1.00
124_R	137_Y	2.433	1.00
69_E	72_E	2.338	1.00
13_V	92_F	2.299	1.00
10_V	40_I	2.259	1.00
37_E	57_N	2.239	1.00
128_V	133_I	2.202	1.00
90_G	113_Q	2.044	1.00
11_K	15_K	1.962	1.00
126_P	133_I	1.921	1.00
18_R	59_D	1.888	1.00
41_G	52_V	1.886	1.00
22_Y	34_I	1.877	1.00
14_A	38_V	1.844	1.00
129_V	134_S	1.820	1.00
17_L	92_F	1.742	1.00
9_L	119_V	1.726	1.00
61_K	65_E	1.652	1.00
92_F	115_A	1.641	1.00
161_E	164_E	1.630	1.00
28_E	31_Q	1.629	1.00
15_K	165_I	1.610	1.00
122_I	137_Y	1.597	1.00
25_A	34_I	1.595	1.00
107_P	118_G	1.574	1.00
14_A	58_A	1.552	1.00
48_Q	80_N	1.544	1.00
37_E	59_D	1.511	1.00
129_V	132_N	1.509	1.00
62_P	65_E	1.490	1.00
10_V	42_I	1.487	1.00
22_Y	154_T	1.481	1.00
42_I	70_S	1.473	1.00
10_V	94_I	1.465	1.00
163_T	167_E	1.458	1.00
39_N	56_R	1.445	1.00
13_V	162_L	1.441	1.00
57_N	60_T	1.438	1.00
28_E	33_K	1.420	1.00
124_R	135_I	1.416	1.00
10_V	58_A	1.413	1.00
16_L	162_L	1.412	1.00
70_S	74_A	1.410	1.00
25_A	149_V	1.376	1.00
77_A	82_L	1.369	1.00
141_L	162_L	1.360	1.00
114_T	149_V	1.349	1.00
126_P	135_I	1.348	1.00
20_H	157_K	1.290	1.00
55_I	69_E	1.274	1.00
153_H	157_K	1.273	1.00
10_V	70_S	1.271	1.00
129_V	136_G	1.270	1.00
13_V	158_F	1.269	1.00
23_L	150_M	1.258	1.00
45_A	153_H	1.251	1.00
97_L	105_F	1.243	1.00
92_F	117_L	1.226	1.00
145_F	155_A	1.225	1.00
147_H	152_G	1.199	1.00
161_E	165_I	1.188	1.00
127_V	138_I	1.188	1.00
160_K	164_E	1.155	1.00
110_N	113_Q	1.148	1.00
38_V	59_D	1.141	1.00
127_V	136_G	1.133	1.00
19_D	165_I	1.125	1.00
45_A	157_K	1.119	1.00
41_G	113_Q	1.104	1.00
93_T	113_Q	1.102	1.00
39_N	57_N	1.091	1.00
23_L	115_A	1.080	1.00
103_D	123_R	1.077	1.00
74_A	78_R	1.063	1.00
103_D	140_W	1.044	1.00
24_N	91_T	1.029	1.00
32_I	149_V	1.028	1.00
117_L	162_L	1.025	1.00
125_A	138_I	1.021	1.00
45_A	100_Y	1.021	1.00
5_Y	122_I	1.006	1.00
64_T	68_K	0.992	1.00
124_R	128_V	0.991	1.00
103_D	121_R	0.990	1.00
119_V	139_M	0.967	1.00
41_G	90_G	0.966	1.00
20_H	154_T	0.964	1.00
39_N	54_V	0.954	1.00
92_F	158_F	0.948	1.00
55_I	70_S	0.937	1.00
10_V	55_I	0.936	1.00
143_L	159_L	0.935	1.00
76_K	82_L	0.926	1.00
54_V	90_G	0.916	1.00
15_K	18_R	0.909	1.00
56_R	85_D	0.903	1.00
72_E	75_D	0.897	1.00
84_P	88_S	0.894	1.00
10_V	66_I	0.891	0.99
82_L	87_V	0.888	0.99
7_D	70_S	0.886	0.99
85_D	88_S	0.882	0.99
51_I	87_V	0.878	0.99
76_K	81_K	0.866	0.99
23_L	158_F	0.860	0.99
57_N	61_K	0.855	0.99
18_R	38_V	0.853	0.99
76_K	83_N	0.845	0.99
9_L	166_L	0.837	0.99
104_S	140_W	0.837	0.99
65_E	68_K	0.823	0.99
7_D	66_I	0.821	0.99
97_L	118_G	0.821	0.99
12_V	166_L	0.800	0.99
3_I	7_D	0.800	0.99
13_V	115_A	0.798	0.99
15_K	19_D	0.797	0.99
117_L	143_L	0.791	0.99
154_T	157_K	0.791	0.99
164_E	171_K	0.789	0.99
26_T	33_K	0.782	0.99
83_N	86_E	0.772	0.99
65_E	69_E	0.771	0.99
168_D	171_K	0.765	0.98
143_L	155_A	0.758	0.98
17_L	158_F	0.752	0.98
43_A	50_L	0.746	0.98
16_L	165_I	0.740	0.98
54_V	89_G	0.739	0.98
72_E	86_E	0.735	0.98
6_T	42_I	0.735	0.98
124_R	130_G	0.728	0.98
35_I	91_T	0.725	0.98
162_L	166_L	0.721	0.98
16_L	161_E	0.720	0.98
17_L	38_V	0.717	0.98
42_I	94_I	0.713	0.98
44_V	78_R	0.712	0.98
22_Y	25_A	0.705	0.97
102_I	156_A	0.703	0.97
6_T	99_M	0.702	0.97
92_F	143_L	0.702	0.97
119_V	141_L	0.701	0.97
51_I	82_L	0.701	0.97
46_L	51_I	0.698	0.97
104_S	142_S	0.698	0.97
125_A	140_W	0.698	0.97
3_I	8_I	0.697	0.97
9_L	139_M	0.694	0.97
56_R	86_E	0.693	0.97
61_K	72_E	0.691	0.97
27_L	149_V	0.687	0.97
158_F	162_L	0.681	0.97
6_T	70_S	0.679	0.97
40_I	92_F	0.677	0.97
169_E	172_L	0.676	0.97
145_F	150_M	0.672	0.96
160_K	163_T	0.668	0.96
9_L	94_I	0.664	0.96
117_L	141_L	0.663	0.96
23_L	154_T	0.659	0.96
109_I	112_P	0.659	0.96
37_E	60_T	0.653	0.96
7_D	67_A	0.650	0.96
120_G	156_A	0.650	0.96
13_V	117_L	0.647	0.96
46_L	77_A	0.647	0.96
109_I	144_T	0.646	0.96
23_L	114_T	0.637	0.95
17_L	23_L	0.636	0.95
141_L	159_L	0.635	0.95
97_L	102_I	0.632	0.95
165_I	171_K	0.632	0.95
106_T	145_F	0.630	0.95
157_K	160_K	0.629	0.95
15_K	172_L	0.628	0.95
54_V	113_Q	0.627	0.95
120_G	142_S	0.627	0.95
104_S	107_P	0.627	0.95
7_D	63_I	0.624	0.95
50_L	116_I	0.621	0.95
128_V	136_G	0.621	0.95
69_E	76_K	0.618	0.94
115_A	143_L	0.614	0.94
4_T	67_A	0.613	0.94
39_N	113_Q	0.611	0.94
39_N	90_G	0.611	0.94
14_A	40_I	0.608	0.94
14_A	18_R	0.607	0.94
39_N	52_V	0.606	0.94
105_F	120_G	0.606	0.94
49_G	151_D	0.605	0.94
11_K	66_I	0.604	0.94
6_T	94_I	0.603	0.94
129_V	133_I	0.603	0.94
6_T	9_L	0.602	0.94
53_P	90_G	0.600	0.94
48_Q	51_I	0.600	0.94
58_A	66_I	0.600	0.94
25_A	114_T	0.599	0.93
84_P	87_V	0.596	0.93
44_V	73_L	0.596	0.93
131_D	135_I	0.594	0.93
126_P	136_G	0.591	0.93
102_I	105_F	0.591	0.93
26_T	114_T	0.583	0.93
25_A	32_I	0.583	0.93
55_I	61_K	0.578	0.92
151_D	154_T	0.577	0.92
26_T	37_E	0.576	0.92
13_V	16_L	0.574	0.92
124_R	129_V	0.573	0.92
90_G	110_N	0.569	0.92
97_L	120_G	0.567	0.91
56_R	69_E	0.566	0.91
39_N	89_G	0.563	0.91
128_V	131_D	0.560	0.91
114_T	150_M	0.558	0.91
11_K	63_I	0.557	0.91
141_L	166_L	0.557	0.91
63_I	67_A	0.548	0.90
90_G	111_P	0.547	0.90
22_Y	32_I	0.546	0.90
108_I	144_T	0.542	0.90
128_V	132_N	0.536	0.89
43_A	152_G	0.531	0.89
105_F	118_G	0.529	0.88
38_V	58_A	0.528	0.88
103_D	125_A	0.525	0.88
97_L	156_A	0.523	0.88
125_A	136_G	0.519	0.88
8_I	12_V	0.519	0.88
11_K	169_E	0.519	0.88
20_H	23_L	0.519	0.88
38_V	91_T	0.516	0.87
107_P	116_I	0.515	0.87
68_K	72_E	0.515	0.87
131_D	137_Y	0.514	0.87
107_P	144_T	0.513	0.87
60_T	65_E	0.512	0.87
6_T	96_N	0.510	0.87
100_Y	156_A	0.505	0.86
44_V	47_D	0.502	0.86
120_G	139_M	0.501	0.86
71_H	74_A	0.501	0.86
110_N	116_I	0.501	0.86
101_D	121_R	0.500	0.86
24_N	38_V	0.500	0.86

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3dvaI	1	0	100	0.083	Contact Map
1sczA	4	0.9944	100	0.096	Contact Map
2ii3A	4	1	100	0.106	Contact Map
4n72A	3	0.9831	100	0.109	Contact Map
1dpbA	4	0.9831	100	0.112	Contact Map
3maeA	3	1	100	0.116	Contact Map
3l60A	3	0.9944	100	0.124	Contact Map
3b8kA	1	0.9831	100	0.125	Contact Map
2xt6A	2	0.8927	100	0.148	Contact Map
3rqcA	4	0.9379	100	0.15	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0075 seconds.