Q97XZ4 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97XZ4 - Orf in partial transposon ISC1904

UniProt:	Q97XZ4	Sequences: MLRPKEVCQRLGISYPTLREYVKKGYIKPVILQSGKWRFNEEDVEKLMGIVKRRKVVLYARVSSKQKDELVNQVKYLEEQVKEYDLVITDIGSGLNMKRKGFLKLLRMILNNEVSRVVIAYPDRLVRFGFEILEETCKAHGCEIVVLNQEEKEEELVEDLISVLVSFSEKLHGMRSHEYEKVKKCAEELKN	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	191 (182)
Sequences:	479 (332)
Seq/√Len:	24.6

SULSO - Q97XZ4 Q97XQ1 Q97U52 Q97U67 Q97XB5 Q97YH2 Q97YU0 Q97YI6 Q97XI0 Q97UQ9 Q97YX0 Q97X40 Q97Z60 Q97X25 Q97WZ6

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
60_A	77_L	4.216	1.00
56_V	116_R	4.209	1.00
81_V	118_V	3.690	1.00
116_R	143_E	3.511	1.00
7_V	11_L	2.774	0.99
102_F	125_L	2.761	0.99
58_L	147_L	2.701	0.99
109_I	137_C	2.615	0.99
13_I	21_Y	2.588	0.99
90_D	101_G	2.482	0.99
17_T	21_Y	2.429	0.98
5_K	9_Q	2.327	0.98
134_E	138_K	2.255	0.97
18_L	39_F	2.197	0.97
110_L	140_H	2.122	0.96
16_P	19_R	2.115	0.96
105_L	114_V	2.074	0.96
2_L	7_V	2.017	0.95
84_Y	145_V	2.017	0.95
22_V	37_W	1.999	0.95
130_F	144_I	1.946	0.94
97_M	131_E	1.908	0.93
58_L	77_L	1.899	0.93
74_V	87_V	1.878	0.93
95_L	128_F	1.808	0.91
130_F	146_V	1.771	0.90
137_C	142_C	1.767	0.90
76_Y	120_A	1.757	0.90
3_R	34_S	1.739	0.89
16_P	24_K	1.706	0.88
55_K	108_M	1.699	0.88
88_I	101_G	1.683	0.88
22_V	29_P	1.638	0.86
118_V	131_E	1.618	0.86
109_I	114_V	1.596	0.85
58_L	87_V	1.596	0.85
109_I	117_V	1.595	0.85
126_V	130_F	1.588	0.84
165_V	176_S	1.582	0.84
108_M	113_E	1.575	0.84
74_V	89_T	1.559	0.83
26_Y	33_Q	1.543	0.83
12_G	141_G	1.534	0.82
97_M	166_S	1.515	0.81
109_I	119_I	1.508	0.81
4_P	19_R	1.472	0.80
17_T	20_E	1.454	0.79
71_V	75_K	1.442	0.78
40_N	43_D	1.379	0.75
118_V	145_V	1.374	0.75
137_C	171_L	1.363	0.74
31_I	37_W	1.360	0.74
154_E	158_E	1.356	0.74
62_V	66_Q	1.328	0.72
95_L	129_G	1.323	0.72
166_S	169_E	1.298	0.70
14_S	20_E	1.255	0.68
165_V	169_E	1.253	0.67
20_E	23_K	1.240	0.67
56_V	143_E	1.238	0.66
66_Q	69_E	1.228	0.66
27_I	30_V	1.225	0.66
69_E	72_N	1.203	0.64
7_V	27_I	1.201	0.64
8_C	13_I	1.195	0.64
121_Y	158_E	1.194	0.64
120_A	177_H	1.186	0.63
4_P	18_L	1.174	0.62
106_L	110_L	1.171	0.62
22_V	39_F	1.149	0.61
90_D	166_S	1.140	0.60
94_G	125_L	1.139	0.60
7_V	44_V	1.137	0.60
58_L	81_V	1.122	0.59
88_I	117_V	1.110	0.58
158_E	169_E	1.106	0.58
169_E	174_M	1.101	0.57
3_R	38_R	1.100	0.57
57_V	74_V	1.098	0.57
15_Y	19_R	1.083	0.56
22_V	27_I	1.074	0.55
130_F	133_L	1.066	0.55
75_K	78_E	1.053	0.54
56_V	92_G	1.037	0.53
88_I	105_L	1.031	0.52
62_V	70_L	1.021	0.51
77_L	147_L	1.017	0.51
163_V	173_G	1.017	0.51
4_P	29_P	1.007	0.50
63_S	66_Q	1.002	0.50
116_R	145_V	0.998	0.50
56_V	118_V	0.994	0.50
8_C	18_L	0.994	0.50
8_C	15_Y	0.990	0.49
43_D	46_K	0.974	0.48
81_V	84_Y	0.969	0.48
28_K	43_D	0.966	0.48
126_V	133_L	0.962	0.47
90_D	120_A	0.959	0.47
155_E	167_F	0.954	0.47
27_I	43_D	0.941	0.46
80_Q	145_V	0.941	0.46
14_S	171_L	0.932	0.45
57_V	88_I	0.927	0.45
66_Q	72_N	0.922	0.44
97_M	126_V	0.914	0.44
165_V	177_H	0.910	0.44
147_L	153_E	0.902	0.43
13_I	20_E	0.902	0.43
74_V	106_L	0.900	0.43
172_H	175_R	0.896	0.43
94_G	102_F	0.891	0.42
117_V	144_I	0.883	0.42
128_F	159_D	0.882	0.42
3_R	33_Q	0.877	0.41
109_I	142_C	0.876	0.41
7_V	18_L	0.870	0.41
90_D	182_V	0.863	0.40
76_Y	148_N	0.859	0.40
169_E	176_S	0.859	0.40
160_L	164_L	0.855	0.40
69_E	120_A	0.848	0.39
11_L	18_L	0.842	0.39
42_E	72_N	0.840	0.39
137_C	168_S	0.839	0.39
157_V	160_L	0.837	0.38
26_Y	34_S	0.836	0.38
2_L	38_R	0.829	0.38
160_L	173_G	0.820	0.37
5_K	34_S	0.818	0.37
170_K	174_M	0.815	0.37
6_E	43_D	0.814	0.37
120_A	165_V	0.811	0.37
19_R	39_F	0.794	0.36
18_L	22_V	0.792	0.35
4_P	15_Y	0.792	0.35
19_R	22_V	0.792	0.35
39_F	43_D	0.789	0.35
71_V	74_V	0.788	0.35
80_Q	84_Y	0.786	0.35
154_E	157_V	0.785	0.35
27_I	133_L	0.780	0.35
54_R	141_G	0.777	0.34
78_E	87_V	0.770	0.34
72_N	161_I	0.766	0.34
77_L	142_C	0.766	0.34
7_V	38_R	0.760	0.33
119_I	144_I	0.759	0.33
92_G	162_S	0.754	0.33
107_R	139_A	0.750	0.33
83_E	118_V	0.747	0.33
22_V	31_I	0.727	0.31
6_E	145_V	0.726	0.31
133_L	137_C	0.721	0.31
39_F	44_V	0.720	0.31
174_M	181_K	0.715	0.31
64_S	72_N	0.712	0.30
159_D	173_G	0.699	0.30
8_C	170_K	0.694	0.29
156_L	165_V	0.689	0.29
2_L	11_L	0.688	0.29
30_V	38_R	0.680	0.28
96_N	140_H	0.678	0.28
156_L	159_D	0.678	0.28
100_K	153_E	0.672	0.28
63_S	127_R	0.672	0.28
4_P	7_V	0.670	0.28
99_R	126_V	0.669	0.28
48_M	51_V	0.668	0.28
50_I	75_K	0.667	0.28
160_L	163_V	0.660	0.27
86_L	99_R	0.658	0.27
44_V	117_V	0.652	0.27
19_R	36_K	0.651	0.27
128_F	163_V	0.651	0.27
106_L	145_V	0.650	0.27
177_H	181_K	0.647	0.27
90_D	144_I	0.646	0.27
152_K	174_M	0.643	0.26
13_I	16_P	0.638	0.26
118_V	135_E	0.635	0.26
9_Q	67_K	0.634	0.26
80_Q	148_N	0.631	0.26
37_W	44_V	0.629	0.26
117_V	146_V	0.623	0.25
19_R	37_W	0.622	0.25
160_L	167_F	0.621	0.25
102_F	126_V	0.621	0.25
159_D	163_V	0.620	0.25
138_K	170_K	0.620	0.25
134_E	144_I	0.613	0.25
54_R	142_C	0.612	0.25
15_Y	37_W	0.612	0.25
14_S	22_V	0.611	0.25
57_V	114_V	0.610	0.25
33_Q	112_N	0.610	0.25
50_I	115_S	0.607	0.24
75_K	79_E	0.599	0.24
168_S	174_M	0.598	0.24
122_P	164_L	0.598	0.24
57_V	105_L	0.595	0.24
91_I	99_R	0.595	0.24
110_L	136_T	0.594	0.24
76_Y	162_S	0.593	0.24
85_D	118_V	0.592	0.24
128_F	173_G	0.592	0.24
133_L	156_L	0.591	0.24
31_I	36_K	0.590	0.24
72_N	75_K	0.590	0.24
134_E	151_E	0.586	0.23
7_V	84_Y	0.584	0.23
19_R	31_I	0.584	0.23
4_P	8_C	0.583	0.23
22_V	32_L	0.583	0.23
136_T	139_A	0.582	0.23
102_F	166_S	0.582	0.23
98_K	161_I	0.579	0.23
64_S	173_G	0.576	0.23
10_R	89_T	0.575	0.23
80_Q	147_L	0.575	0.23
65_K	120_A	0.572	0.23
54_R	111_N	0.572	0.23
57_V	149_Q	0.567	0.22
102_F	115_S	0.567	0.22
156_L	167_F	0.565	0.22
34_S	112_N	0.562	0.22
98_K	140_H	0.555	0.22
27_I	52_K	0.555	0.22
8_C	12_G	0.552	0.22
82_K	105_L	0.552	0.22
126_V	162_S	0.552	0.22
95_L	132_I	0.550	0.22
55_K	115_S	0.547	0.21
6_E	32_L	0.545	0.21
56_V	115_S	0.545	0.21
6_E	156_L	0.545	0.21
12_G	128_F	0.544	0.21
98_K	170_K	0.542	0.21
8_C	102_F	0.542	0.21
46_K	121_Y	0.538	0.21
180_E	183_K	0.538	0.21
76_Y	177_H	0.537	0.21
6_E	10_R	0.537	0.21
89_T	136_T	0.534	0.21
45_E	48_M	0.532	0.21
84_Y	147_L	0.532	0.21
177_H	183_K	0.531	0.21
100_K	115_S	0.531	0.21
146_V	164_L	0.529	0.20
122_P	178_E	0.529	0.20
92_G	143_E	0.528	0.20
63_S	128_F	0.526	0.20
39_F	168_S	0.526	0.20
4_P	21_Y	0.525	0.20
114_V	142_C	0.524	0.20
5_K	8_C	0.522	0.20
76_Y	90_D	0.518	0.20
23_K	100_K	0.518	0.20
2_L	13_I	0.517	0.20
129_G	168_S	0.516	0.20
129_G	145_V	0.516	0.20
176_S	179_Y	0.516	0.20
23_K	31_I	0.514	0.20
85_D	147_L	0.513	0.20
10_R	144_I	0.511	0.20
151_E	164_L	0.509	0.20
90_D	97_M	0.509	0.20
118_V	180_E	0.508	0.20
117_V	125_L	0.504	0.19
123_D	127_R	0.503	0.19
30_V	43_D	0.501	0.19
100_K	164_L	0.501	0.19
118_V	133_L	0.500	0.19

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3ilxA	2	0.7173	99.9	0.657	Contact Map
3lhkA	2	0.7277	99.9	0.667	Contact Map
3g13A	2	0.7277	99.8	0.743	Contact Map
3bvpA	4	0.623	99.8	0.751	Contact Map
4bqqA	2	0.6963	99.7	0.752	Contact Map
2mhcA	1	0.5602	99.7	0.753	Contact Map
3guvA	2	0.6859	99.7	0.759	Contact Map
2gm5A	4	0.6178	99.7	0.766	Contact Map
1gdtA	2	0.6911	99.7	0.77	Contact Map
3pkzA	4	0.5864	99.7	0.771	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0079 seconds.