Q97XZ1 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97XZ1 - Uncharacterized protein

UniProt:	Q97XZ1	Sequences: MGDGLMVKVGKVRIMELLEPEFFGTVLNHNISVIENGPCGGLMMIDTGLPGYLDQIESYLKAWGYSLEDISDIVITHWHHDHAGNAMAIKRISDAKIYAHVDELGDLENPPKYSTIYSDELGVSLPVFKRTMERINKLHYEPVKVDFALKGGEDLGGFRVIHVPGHTKGHIALFDGKCLVVGDAVRNVRNKLSPPLRIFSWNYELAVNSFNYLISLPYTVLIPFHGDIVIRNF	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	233 (181)
Sequences:	14127 (10561)
Seq/√Len:	785.0

ECOLI - YCBL GLO2
BACSU - YFLN YYBB YOBT YQJP YQGX PKSB YTNP YRKH
HALSA - Q9HSH2 Q9HRG5 Q9HNJ9 Q9HSD1 Q9HQ50 Q9HNJ2 Q9HQ42 O54647
SULSO - Q97XZ1 Q97YZ2 Q97VU4 Q97U88 Q97UR2 Q97UV2 Q97VU0 Q97Y13 Q97YH8 Q7LYK3 Q97WC2

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
163_V	172_A	4.395	1.00
41_G	71_S	3.993	1.00
72_D	98_Y	3.173	1.00
75_I	86_A	3.075	1.00
74_V	173_L	2.594	1.00
101_V	150_K	2.427	1.00
43_M	72_D	2.331	1.00
160_V	171_I	2.296	1.00
35_E	42_L	2.275	1.00
202_N	205_L	2.213	1.00
45_I	76_T	2.203	1.00
57_E	92_I	2.188	1.00
32_S	222_I	2.134	1.00
96_K	147_F	2.128	1.00
98_Y	147_F	2.118	1.00
154_D	157_G	2.099	1.00
160_V	173_L	2.091	1.00
177_K	219_T	2.026	1.00
72_D	96_K	1.997	1.00
42_L	65_Y	1.929	1.00
100_H	171_I	1.926	1.00
178_C	222_I	1.923	1.00
154_D	159_R	1.912	1.00
100_H	162_H	1.851	1.00
103_E	169_G	1.789	1.00
159_R	174_F	1.733	1.00
151_G	212_Y	1.730	1.00
174_F	177_K	1.691	1.00
172_A	179_L	1.687	1.00
150_K	153_E	1.677	1.00
32_S	180_V	1.623	1.00
174_F	179_L	1.609	1.00
161_I	174_F	1.587	1.00
59_Y	63_W	1.572	1.00
170_H	182_G	1.568	1.00
37_G	40_G	1.563	1.00
35_E	65_Y	1.563	1.00
41_G	72_D	1.545	1.00
104_L	108_E	1.539	1.00
45_I	180_V	1.531	1.00
42_L	70_I	1.524	1.00
57_E	61_K	1.510	1.00
59_Y	62_A	1.502	1.00
90_K	146_D	1.452	1.00
98_Y	149_L	1.449	1.00
88_A	92_I	1.439	1.00
192_L	195_P	1.437	1.00
70_I	95_A	1.424	1.00
205_L	208_N	1.387	1.00
212_Y	215_S	1.357	1.00
87_M	91_R	1.349	1.00
99_A	103_E	1.312	1.00
104_L	148_A	1.309	1.00
101_V	148_A	1.308	1.00
53_L	88_A	1.281	1.00
43_M	74_V	1.260	1.00
41_G	66_S	1.257	1.00
163_V	209_S	1.235	1.00
44_M	70_I	1.230	1.00
45_I	173_L	1.223	1.00
42_L	71_S	1.199	1.00
149_L	171_I	1.189	1.00
86_A	97_I	1.183	1.00
47_T	73_I	1.180	1.00
220_V	228_I	1.178	1.00
172_A	213_L	1.175	1.00
207_V	211_N	1.170	1.00
76_T	182_G	1.167	1.00
184_A	213_L	1.139	1.00
181_V	221_L	1.135	1.00
163_V	170_H	1.130	1.00
58_S	61_K	1.129	1.00
103_E	167_T	1.127	1.00
161_I	212_Y	1.127	1.00
58_S	62_A	1.126	1.00
147_F	153_E	1.108	1.00
54_D	58_S	1.089	1.00
53_L	57_E	1.077	1.00
87_M	90_K	1.077	1.00
47_T	86_A	1.077	1.00
152_G	159_R	1.070	1.00
102_D	162_H	1.065	1.00
204_E	208_N	1.056	1.00
211_N	215_S	1.043	1.00
33_V	42_L	1.043	1.00
43_M	158_F	1.035	1.00
203_Y	207_V	1.033	1.00
37_G	41_G	1.031	1.00
221_L	229_V	1.026	1.00
34_I	45_I	1.021	1.00
167_T	170_H	1.014	1.00
90_K	97_I	1.013	1.00
165_G	209_S	1.012	1.00
61_K	92_I	1.011	1.00
172_A	184_A	1.007	1.00
35_E	59_Y	0.984	1.00
44_M	47_T	0.980	1.00
206_A	210_F	0.970	1.00
178_C	220_V	0.969	1.00
53_L	85_N	0.968	1.00
102_D	105_G	0.962	1.00
76_T	173_L	0.945	1.00
78_W	99_A	0.945	1.00
151_G	162_H	0.936	1.00
174_F	219_T	0.934	1.00
174_F	216_L	0.932	1.00
45_I	74_V	0.919	1.00
210_F	214_I	0.908	1.00
57_E	93_S	0.906	1.00
55_Q	59_Y	0.904	1.00
75_I	97_I	0.900	1.00
31_I	56_I	0.895	1.00
78_W	103_E	0.895	1.00
60_L	70_I	0.886	1.00
187_N	227_D	0.879	1.00
156_G	176_G	0.878	1.00
101_V	105_G	0.875	1.00
73_I	86_A	0.875	1.00
211_N	214_I	0.875	1.00
161_I	172_A	0.871	1.00
174_F	218_Y	0.866	1.00
36_N	156_G	0.864	1.00
36_N	40_G	0.863	1.00
73_I	95_A	0.862	1.00
105_G	109_N	0.861	1.00
74_V	171_I	0.856	1.00
212_Y	216_L	0.855	1.00
103_E	106_D	0.853	1.00
164_P	209_S	0.849	1.00
208_N	211_N	0.848	1.00
159_R	216_L	0.847	1.00
143_V	146_D	0.845	1.00
32_S	224_F	0.830	1.00
29_H	48_G	0.824	1.00
101_V	104_L	0.823	1.00
109_N	112_K	0.815	1.00
35_E	63_W	0.813	1.00
149_L	155_L	0.811	1.00
157_G	175_D	0.810	1.00
33_V	44_M	0.809	1.00
163_V	184_A	0.806	1.00
179_L	221_L	0.803	1.00
149_L	153_E	0.799	1.00
168_K	205_L	0.797	1.00
30_N	226_G	0.785	1.00
71_S	96_K	0.785	1.00
36_N	41_G	0.784	1.00
199_F	202_N	0.781	1.00
73_I	97_I	0.776	1.00
70_I	93_S	0.775	1.00
184_A	206_A	0.775	1.00
198_I	201_W	0.773	1.00
179_L	216_L	0.773	1.00
44_M	56_I	0.771	1.00
203_Y	206_A	0.771	1.00
74_V	158_F	0.759	1.00
110_P	113_Y	0.759	1.00
85_N	88_A	0.746	1.00
55_Q	58_S	0.746	1.00
42_L	60_L	0.745	1.00
54_D	57_E	0.742	1.00
44_M	60_L	0.739	1.00
181_V	185_V	0.732	1.00
105_G	108_E	0.729	1.00
99_A	107_L	0.714	1.00
112_K	115_T	0.713	1.00
75_I	83_A	0.707	1.00
113_Y	116_I	0.704	1.00
139_H	143_V	0.694	1.00
170_H	184_A	0.690	1.00
96_K	146_D	0.685	1.00
184_A	209_S	0.683	1.00
178_C	181_V	0.683	1.00
31_I	47_T	0.681	1.00
175_D	178_C	0.681	1.00
158_F	173_L	0.679	1.00
89_I	92_I	0.679	1.00
223_P	226_G	0.678	1.00
52_Y	55_Q	0.677	1.00
35_E	40_G	0.675	1.00
61_K	64_G	0.673	1.00
72_D	147_F	0.671	1.00
100_H	103_E	0.670	1.00
88_A	91_R	0.669	1.00
149_L	173_L	0.666	1.00
36_N	43_M	0.662	1.00
187_N	229_V	0.662	1.00
30_N	224_F	0.661	1.00
60_L	65_Y	0.661	1.00
109_N	113_Y	0.661	1.00
99_A	104_L	0.659	1.00
161_I	216_L	0.656	1.00
111_P	114_S	0.655	1.00
91_R	141_E	0.655	1.00
200_S	203_Y	0.652	1.00
135_I	138_L	0.649	1.00
40_G	64_G	0.649	1.00
33_V	59_Y	0.648	1.00
222_I	228_I	0.646	1.00
151_G	155_L	0.644	1.00
149_L	160_V	0.642	1.00
138_L	142_P	0.637	1.00
180_V	222_I	0.635	1.00
108_E	144_K	0.634	1.00
200_S	206_A	0.623	1.00
33_V	70_I	0.622	1.00
73_I	89_I	0.622	1.00
161_I	179_L	0.620	1.00
56_I	85_N	0.619	1.00
83_A	86_A	0.618	1.00
33_V	65_Y	0.618	1.00
47_T	85_N	0.618	1.00
50_P	85_N	0.615	1.00
221_L	225_H	0.612	1.00
149_L	152_G	0.612	1.00
104_L	107_L	0.601	1.00
218_Y	221_L	0.599	1.00
145_V	148_A	0.596	1.00
36_N	42_L	0.596	1.00
172_A	209_S	0.596	1.00
106_D	168_K	0.596	1.00
86_A	90_K	0.594	1.00
66_S	71_S	0.589	1.00
208_N	212_Y	0.588	1.00
27_L	80_H	0.587	1.00
34_I	43_M	0.587	1.00
78_W	83_A	0.586	1.00
31_I	48_G	0.579	1.00
106_D	109_N	0.578	1.00
57_E	88_A	0.577	1.00
144_K	148_A	0.577	1.00
181_V	223_P	0.574	1.00
50_P	84_G	0.566	1.00
174_F	217_P	0.566	1.00
177_K	217_P	0.562	1.00
103_E	107_L	0.561	1.00
181_V	184_A	0.560	1.00
139_H	142_P	0.559	1.00
93_S	96_K	0.559	1.00
61_K	66_S	0.556	1.00
136_N	139_H	0.554	1.00
153_E	160_V	0.553	1.00
142_P	145_V	0.553	1.00
87_M	141_E	0.552	1.00
29_H	32_S	0.547	1.00
48_G	56_I	0.547	1.00
90_K	94_D	0.546	1.00
53_L	92_I	0.546	1.00
99_A	148_A	0.544	1.00
152_G	212_Y	0.539	1.00
213_L	216_L	0.538	1.00
107_L	110_P	0.537	1.00
207_V	214_I	0.535	1.00
162_H	171_I	0.533	1.00
80_H	84_G	0.532	1.00
150_K	162_H	0.531	1.00
147_F	150_K	0.530	1.00
110_P	114_S	0.527	1.00
102_D	169_G	0.522	1.00
33_V	60_L	0.521	1.00
168_K	200_S	0.519	1.00
66_S	70_I	0.517	1.00
106_D	111_P	0.517	1.00
195_P	206_A	0.515	1.00
102_D	168_K	0.515	1.00
44_M	89_I	0.511	1.00
185_V	221_L	0.510	1.00
34_I	158_F	0.508	1.00
197_R	200_S	0.506	1.00
140_Y	144_K	0.503	1.00
77_H	183_D	0.501	1.00
23_F	26_V	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2zo4A	1	0.9185	100	0.343	Contact Map
3aj3A	2	0.9485	100	0.387	Contact Map
2fhxA	2	0.9185	100	0.392	Contact Map
1k07A	1	0.8927	100	0.393	Contact Map
2vw8A	2	0.9485	100	0.397	Contact Map
2yheA	3	0.9828	100	0.404	Contact Map
3m8tA	1	0.8884	100	0.406	Contact Map
2zwrA	1	0.8112	100	0.412	Contact Map
1smlA	1	0.9013	100	0.412	Contact Map
4yslA	2	0.8627	100	0.415	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0074 seconds.