Q97XY5 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97XY5 - Uncharacterized protein

UniProt:	Q97XY5	Sequences: MVDYLVSNVKEVKMDRVPVNGSKNAFIQWLVTKENGANYAVRKFTLLKDGIIPMHIHKYQETVIVTKGKCKVCVSDKVYELREGDYIFINSNVKHAIINEGDQLEFFCIIDYSDDMRIITLDEDCNR	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	127 (108)
Sequences:	292 (222)
Seq/√Len:	21.3

HALSA - Q9HNB4
SULSO - Q97XY5

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
67_K	105_E	3.514	1.00
70_C	104_L	2.994	0.99
63_V	97_I	2.901	0.99
42_R	108_C	2.555	0.98
23_K	50_G	2.523	0.98
8_N	11_E	2.403	0.97
30_L	43_K	2.353	0.97
24_N	47_L	2.295	0.96
69_K	82_R	2.216	0.95
69_K	80_E	2.072	0.93
71_K	80_E	2.063	0.93
43_K	105_E	2.038	0.93
52_I	96_A	1.945	0.91
47_L	103_Q	1.892	0.90
71_K	78_V	1.871	0.89
39_Y	60_Q	1.871	0.89
41_V	109_I	1.866	0.89
32_T	40_A	1.859	0.89
81_L	104_L	1.858	0.89
14_M	28_Q	1.853	0.89
44_F	106_F	1.668	0.83
71_K	98_I	1.594	0.80
44_F	108_C	1.592	0.80
29_W	40_A	1.526	0.77
73_C	96_A	1.505	0.76
37_A	62_T	1.480	0.75
12_V	86_Y	1.459	0.73
46_L	50_G	1.448	0.73
47_L	86_Y	1.420	0.71
38_N	41_V	1.346	0.67
66_T	101_G	1.335	0.67
7_S	86_Y	1.309	0.65
52_I	63_V	1.273	0.63
40_A	55_H	1.237	0.60
74_V	79_Y	1.236	0.60
27_I	110_I	1.233	0.60
45_T	105_E	1.231	0.60
48_K	99_N	1.216	0.59
7_S	10_K	1.212	0.59
36_G	84_G	1.180	0.57
52_I	97_I	1.179	0.57
71_K	100_E	1.146	0.55
28_Q	45_T	1.142	0.54
17_V	22_S	1.134	0.54
20_N	69_K	1.102	0.52
58_K	92_N	1.096	0.51
13_K	98_I	1.075	0.50
42_R	95_H	1.069	0.49
50_G	104_L	1.058	0.49
95_H	108_C	1.029	0.47
41_V	62_T	1.019	0.46
67_K	83_E	1.017	0.46
76_D	107_F	1.013	0.46
51_I	96_A	1.003	0.45
25_A	46_L	1.002	0.45
42_R	110_I	1.000	0.45
59_Y	85_D	0.998	0.45
45_T	100_E	0.987	0.44
80_E	100_E	0.982	0.44
61_E	111_D	0.981	0.44
74_V	93_V	0.972	0.43
29_W	110_I	0.957	0.42
72_V	106_F	0.955	0.42
38_N	62_T	0.925	0.40
57_H	70_C	0.922	0.40
26_F	65_V	0.921	0.40
25_A	109_I	0.879	0.37
53_P	56_I	0.877	0.37
6_V	78_V	0.876	0.37
43_K	67_K	0.864	0.36
41_V	111_D	0.860	0.36
62_T	111_D	0.858	0.36
46_L	107_F	0.848	0.35
6_V	103_Q	0.844	0.35
22_S	105_E	0.822	0.33
110_I	114_D	0.816	0.33
7_S	45_T	0.811	0.33
57_H	63_V	0.797	0.32
83_E	91_S	0.795	0.32
40_A	114_D	0.795	0.32
17_V	99_N	0.790	0.32
32_T	35_N	0.789	0.32
60_Q	109_I	0.789	0.32
44_F	97_I	0.775	0.31
92_N	111_D	0.769	0.30
31_V	77_K	0.766	0.30
46_L	105_E	0.764	0.30
43_K	64_I	0.756	0.30
21_G	29_W	0.753	0.29
42_R	106_F	0.750	0.29
46_L	91_S	0.750	0.29
39_Y	62_T	0.748	0.29
67_K	103_Q	0.746	0.29
25_A	80_E	0.746	0.29
17_V	20_N	0.746	0.29
61_E	108_C	0.742	0.29
41_V	64_I	0.727	0.28
56_I	66_T	0.724	0.28
16_R	66_T	0.719	0.28
56_I	92_N	0.706	0.27
45_T	70_C	0.693	0.26
46_L	114_D	0.685	0.26
45_T	103_Q	0.682	0.26
90_N	93_V	0.680	0.26
81_L	84_G	0.675	0.25
7_S	12_V	0.675	0.25
106_F	110_I	0.668	0.25
55_H	105_E	0.663	0.25
49_D	81_L	0.656	0.24
63_V	96_A	0.638	0.24
25_A	52_I	0.636	0.23
72_V	87_I	0.635	0.23
13_K	102_D	0.629	0.23
23_K	77_K	0.628	0.23
29_W	32_T	0.622	0.23
88_F	112_Y	0.619	0.23
14_M	69_K	0.618	0.23
21_G	57_H	0.616	0.22
13_K	82_R	0.615	0.22
38_N	60_Q	0.614	0.22
36_G	88_F	0.612	0.22
49_D	61_E	0.609	0.22
95_H	106_F	0.606	0.22
27_I	44_F	0.605	0.22
30_L	115_D	0.605	0.22
10_K	24_N	0.604	0.22
52_I	57_H	0.594	0.21
55_H	111_D	0.583	0.21
70_C	109_I	0.581	0.21
31_V	86_Y	0.580	0.21
8_N	107_F	0.577	0.21
37_A	111_D	0.574	0.21
48_K	113_S	0.566	0.20
17_V	78_V	0.565	0.20
87_I	97_I	0.564	0.20
17_V	55_H	0.562	0.20
37_A	88_F	0.561	0.20
38_N	63_V	0.557	0.20
40_A	112_Y	0.555	0.20
54_M	96_A	0.555	0.20
55_H	95_H	0.553	0.20
20_N	83_E	0.551	0.20
55_H	114_D	0.541	0.19
8_N	83_E	0.536	0.19
37_A	104_L	0.535	0.19
57_H	68_G	0.535	0.19
33_K	88_F	0.533	0.19
49_D	56_I	0.532	0.19
11_E	76_D	0.532	0.19
16_R	103_Q	0.528	0.19
21_G	36_G	0.526	0.19
9_V	70_C	0.524	0.18
13_K	16_R	0.524	0.18
60_Q	111_D	0.517	0.18
22_S	99_N	0.515	0.18
26_F	52_I	0.513	0.18
79_Y	89_I	0.509	0.18
74_V	90_N	0.506	0.18
32_T	86_Y	0.505	0.18
24_N	92_N	0.504	0.18
91_S	103_Q	0.502	0.18
17_V	44_F	0.500	0.18

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1vj2A	2	0.8819	99.8	0.598	Contact Map
3ibmA	2	0.9528	99.8	0.608	Contact Map
1sfnA	5	0.9055	99.8	0.611	Contact Map
3jzvA	5	0.9606	99.8	0.616	Contact Map
3ht1A	2	0.9843	99.8	0.623	Contact Map
1rc6A	4	0.8425	99.8	0.624	Contact Map
3kgzA	2	0.9921	99.8	0.624	Contact Map
1sefA	5	0.9134	99.8	0.628	Contact Map
4uxaA	6	0.9764	99.7	0.632	Contact Map
4bifA	4	0.9685	99.7	0.636	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0058 seconds.