Q97XX9 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97XX9 - Molybdopterin oxidoreductase, iron-sulfur binding subunit

UniProt:	Q97XX9	Sequences: MSTQVSNPYIQFGNTQPCKHWGFVVKVDQCLGCDACVAACTIENQTPFWRGLFRTHVEDLELGEYPNTQRVFVPRLCMQCENPPCYYVCPTGATQIVAGGIVVVDEYKCMGCLYCVEACPYGARYFYTYEDIEKSKEYFGLNSIHVVPHVDKCTFCYGTAPEGTYTPACVRTCPGHARVFGCLDDPNSEVSILVNTGQAVVLNPELNVQPKVFYVFNRQLGRGGGGNS	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	228 (182)
Sequences:	2464 (1378)
Seq/√Len:	102.1

ECOLI - NRFC YDHX FDOH FDNH YNFG HYBA DMSB HYFA HYCB YDHY HYDN YSAA YGFS NARY NARH
BACSU - NARH
HALSA - DMSB
SULSO - Q97XX9 Q97V38 Q97V75

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
43_E	158_G	3.123	1.00
23_F	155_F	2.871	1.00
167_P	170_V	2.824	1.00
94_T	124_R	2.658	1.00
201_V	204_P	2.446	1.00
86_Y	94_T	2.410	1.00
63_G	66_P	2.152	1.00
83_P	96_I	2.142	1.00
113_L	126_F	2.095	1.00
54_R	151_D	2.055	1.00
19_K	184_D	2.002	1.00
116_V	150_V	1.978	1.00
22_G	183_L	1.969	1.00
24_V	190_V	1.949	1.00
155_F	212_V	1.948	1.00
170_V	178_R	1.880	1.00
97_V	161_P	1.844	1.00
30_C	36_C	1.843	1.00
157_Y	161_P	1.801	1.00
30_C	33_C	1.786	1.00
113_L	128_T	1.783	1.00
88_V	114_Y	1.769	1.00
88_V	118_A	1.757	1.00
81_E	211_K	1.752	1.00
76_L	212_V	1.722	1.00
30_C	173_C	1.693	1.00
185_D	188_S	1.687	1.00
44_N	158_G	1.682	1.00
105_D	108_K	1.667	1.00
188_S	191_S	1.656	1.00
187_N	192_I	1.655	1.00
179_V	193_L	1.643	1.00
189_E	192_I	1.635	1.00
19_K	182_C	1.629	1.00
127_Y	151_D	1.614	1.00
89_C	115_C	1.614	1.00
201_V	209_Q	1.609	1.00
94_T	104_V	1.600	1.00
89_C	109_C	1.562	1.00
20_H	81_E	1.552	1.00
33_C	36_C	1.542	1.00
101_I	160_A	1.519	1.00
33_C	173_C	1.516	1.00
25_V	178_R	1.511	1.00
109_C	115_C	1.501	1.00
159_T	171_R	1.500	1.00
44_N	154_T	1.497	1.00
84_P	208_V	1.489	1.00
113_L	116_V	1.467	1.00
31_L	175_G	1.462	1.00
159_T	164_T	1.446	1.00
24_V	193_L	1.436	1.00
192_I	196_T	1.427	1.00
39_A	172_T	1.423	1.00
86_Y	96_I	1.421	1.00
126_F	150_V	1.389	1.00
25_V	212_V	1.384	1.00
189_E	193_L	1.362	0.99
182_C	185_D	1.359	0.99
179_V	189_E	1.353	0.99
34_D	37_V	1.345	0.99
36_C	173_C	1.304	0.99
83_P	86_Y	1.277	0.99
75_R	202_L	1.268	0.99
199_A	215_V	1.255	0.99
74_P	178_R	1.251	0.99
43_E	159_T	1.247	0.99
95_Q	105_D	1.245	0.99
97_V	101_I	1.242	0.99
63_G	67_N	1.230	0.99
160_A	180_F	1.224	0.99
55_T	178_R	1.213	0.99
24_V	215_V	1.176	0.98
28_D	197_G	1.176	0.98
81_E	209_Q	1.166	0.98
166_T	170_V	1.163	0.98
25_V	74_P	1.160	0.98
95_Q	103_V	1.159	0.98
201_V	206_L	1.156	0.98
39_A	168_A	1.151	0.98
128_T	146_V	1.144	0.98
90_P	109_C	1.133	0.98
103_V	154_T	1.122	0.98
76_L	178_R	1.117	0.98
188_S	192_I	1.117	0.98
90_P	115_C	1.114	0.98
203_N	206_L	1.106	0.98
74_P	214_Y	1.100	0.98
20_H	211_K	1.085	0.97
194_V	213_F	1.084	0.97
91_T	94_T	1.081	0.97
109_C	112_C	1.079	0.97
197_G	215_V	1.073	0.97
28_D	215_V	1.068	0.97
22_G	186_P	1.065	0.97
194_V	199_A	1.062	0.97
97_V	157_Y	1.052	0.97
96_I	211_K	1.039	0.97
191_S	195_N	1.033	0.96
81_E	96_I	1.031	0.96
27_V	74_P	1.027	0.96
22_G	190_V	1.018	0.96
183_L	187_N	1.004	0.96
62_L	69_Q	1.003	0.96
88_V	94_T	0.993	0.96
35_A	172_T	0.980	0.95
112_C	115_C	0.957	0.95
125_Y	151_D	0.947	0.94
20_H	184_D	0.945	0.94
106_E	149_H	0.941	0.94
21_W	180_F	0.941	0.94
54_R	57_V	0.931	0.94
46_T	54_R	0.927	0.94
101_I	157_Y	0.914	0.93
89_C	112_C	0.913	0.93
18_C	184_D	0.912	0.93
25_V	76_L	0.907	0.93
104_V	124_R	0.904	0.93
43_E	168_A	0.901	0.93
82_N	87_Y	0.901	0.93
154_T	158_G	0.895	0.92
84_P	118_A	0.888	0.92
82_N	209_Q	0.887	0.92
192_I	195_N	0.885	0.92
99_G	161_P	0.880	0.92
166_T	171_R	0.879	0.92
104_V	150_V	0.870	0.91
164_T	171_R	0.869	0.91
35_A	38_A	0.868	0.91
56_H	75_R	0.865	0.91
96_I	102_V	0.860	0.91
167_P	178_R	0.858	0.91
201_V	213_F	0.857	0.91
32_G	177_A	0.856	0.91
88_V	117_E	0.849	0.90
113_L	150_V	0.843	0.90
190_V	193_L	0.842	0.90
91_T	108_K	0.842	0.90
63_G	68_T	0.841	0.90
194_V	198_Q	0.838	0.90
91_T	112_C	0.837	0.90
181_G	185_D	0.834	0.89
187_N	191_S	0.833	0.89
59_D	70_R	0.828	0.89
186_P	191_S	0.826	0.89
103_V	157_Y	0.821	0.89
114_Y	117_E	0.821	0.89
55_T	59_D	0.820	0.89
90_P	110_M	0.819	0.89
35_A	42_I	0.814	0.88
64_E	67_N	0.810	0.88
116_V	128_T	0.800	0.87
126_F	148_P	0.797	0.87
41_T	46_T	0.786	0.86
53_F	56_H	0.768	0.85
29_Q	193_L	0.757	0.84
159_T	168_A	0.755	0.84
76_L	155_F	0.751	0.84
97_V	103_V	0.747	0.84
24_V	194_V	0.747	0.84
55_T	74_P	0.746	0.83
93_A	108_K	0.745	0.83
40_C	153_C	0.736	0.83
191_S	194_V	0.735	0.83
186_P	190_V	0.731	0.82
26_K	215_V	0.723	0.81
124_R	150_V	0.720	0.81
91_T	110_M	0.718	0.81
23_F	170_V	0.717	0.81
45_Q	151_D	0.713	0.81
63_G	69_Q	0.712	0.80
28_D	217_N	0.710	0.80
25_V	214_Y	0.709	0.80
155_F	180_F	0.707	0.80
42_I	172_T	0.706	0.80
22_G	211_K	0.705	0.80
20_H	183_L	0.701	0.79
89_C	111_G	0.701	0.79
113_L	151_D	0.698	0.79
61_E	64_E	0.696	0.79
55_T	76_L	0.695	0.79
41_T	53_F	0.687	0.78
84_P	206_L	0.683	0.78
121_Y	208_V	0.683	0.78
65_Y	68_T	0.681	0.77
23_F	180_F	0.674	0.77
207_N	210_P	0.673	0.77
194_V	197_G	0.673	0.77
176_H	179_V	0.672	0.77
21_W	101_I	0.670	0.76
61_E	68_T	0.667	0.76
183_L	191_S	0.666	0.76
60_L	66_P	0.662	0.75
23_F	55_T	0.662	0.75
51_G	55_T	0.655	0.75
61_E	70_R	0.650	0.74
110_M	115_C	0.645	0.74
101_I	155_F	0.644	0.73
153_C	156_C	0.640	0.73
40_C	156_C	0.640	0.73
182_C	186_P	0.632	0.72
42_I	171_R	0.630	0.72
38_A	41_T	0.630	0.72
121_Y	210_P	0.627	0.71
27_V	73_V	0.627	0.71
128_T	148_P	0.620	0.71
78_M	123_A	0.617	0.70
201_V	205_E	0.616	0.70
31_L	174_P	0.614	0.70
90_P	112_C	0.610	0.69
38_A	83_P	0.610	0.69
193_L	196_T	0.610	0.69
51_G	59_D	0.610	0.69
75_R	78_M	0.603	0.69
202_L	208_V	0.603	0.69
23_F	76_L	0.601	0.68
32_G	36_C	0.601	0.68
82_N	92_G	0.601	0.68
111_G	115_C	0.598	0.68
51_G	57_V	0.594	0.67
185_D	190_V	0.594	0.67
91_T	104_V	0.592	0.67
55_T	58_E	0.586	0.66
21_W	160_A	0.584	0.66
126_F	147_V	0.583	0.66
172_T	175_G	0.581	0.66
122_G	125_Y	0.578	0.65
202_L	206_L	0.576	0.65
99_G	157_Y	0.573	0.65
35_A	174_P	0.572	0.64
37_V	57_V	0.570	0.64
47_P	52_L	0.570	0.64
21_W	99_G	0.568	0.64
32_G	123_A	0.567	0.64
58_E	149_H	0.567	0.64
29_Q	176_H	0.563	0.63
51_G	56_H	0.561	0.63
22_G	213_F	0.558	0.63
127_Y	146_V	0.556	0.62
23_F	212_V	0.555	0.62
50_R	54_R	0.555	0.62
183_L	186_P	0.547	0.61
92_G	98_A	0.547	0.61
76_L	214_Y	0.546	0.61
57_V	74_P	0.539	0.60
89_C	110_M	0.538	0.60
44_N	54_R	0.537	0.60
58_E	62_L	0.536	0.60
21_W	182_C	0.532	0.59
70_R	123_A	0.531	0.59
182_C	188_S	0.529	0.59
152_K	156_C	0.529	0.59
45_Q	48_F	0.527	0.58
193_L	197_G	0.526	0.58
87_Y	114_Y	0.525	0.58
86_Y	90_P	0.524	0.58
32_G	173_C	0.523	0.58
112_C	150_V	0.522	0.58
21_W	122_G	0.518	0.57
179_V	188_S	0.517	0.57
56_H	125_Y	0.516	0.57
106_E	147_V	0.515	0.57
43_E	171_R	0.515	0.57
96_I	100_G	0.514	0.56
127_Y	147_V	0.514	0.56
34_D	38_A	0.511	0.56
52_L	126_F	0.511	0.56
78_M	202_L	0.508	0.56
110_M	114_Y	0.508	0.56
86_Y	95_Q	0.503	0.55
206_L	211_K	0.503	0.55
106_E	180_F	0.501	0.54
88_V	124_R	0.500	0.54

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2ivfB	1	0.8465	100	0.398	Contact Map
1ti6B	2	0.8333	100	0.408	Contact Map
1kqfB	3	0.9167	100	0.453	Contact Map
2vpzB	2	0.8289	100	0.469	Contact Map
1h0hB	1	0.8333	100	0.473	Contact Map
1q16B	2	0.8596	100	0.518	Contact Map
4z3xE	2	0.7237	100	0.633	Contact Map
3mm5B	2	0.9167	99.8	0.743	Contact Map
1jnrB	1	0.6228	99.5	0.796	Contact Map
3gyxB	1	0.4649	99.4	0.812	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0073 seconds.