Q97XR7 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97XR7 - Uncharacterized protein

UniProt:	Q97XR7	Sequences: MREEAEKWLRQALEDLATAKDTITTGHYYASAFWAEQAAEKALKALLIAGGKIERTHDLNELLEIIKEEIGLSVEEIRSEVIKLTLHYTISRYPDAANTIPYSLYSKEDAEELVKKAEKVIEWVKRNLH	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	129 (117)
Sequences:	461 (421)
Seq/√Len:	38.9

SULSO - Q97XR7 Q97VT0 Q97XB1 Q97XN9

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
20_K	118_E	6.121	1.00
13_L	125_K	4.814	1.00
15_D	41_K	3.724	1.00
58_D	85_T	2.913	1.00
107_K	111_E	2.839	1.00
42_A	121_I	2.690	1.00
22_T	34_W	2.435	1.00
18_T	22_T	2.391	1.00
87_H	105_Y	2.379	1.00
11_Q	29_Y	2.354	1.00
80_E	116_K	2.297	1.00
30_A	34_W	2.269	1.00
43_L	59_L	2.227	0.99
15_D	34_W	1.821	0.98
115_K	118_E	1.722	0.97
63_L	81_V	1.645	0.96
13_L	121_I	1.639	0.96
9_L	42_A	1.637	0.96
11_Q	105_Y	1.592	0.95
21_D	27_H	1.560	0.94
86_L	109_D	1.557	0.94
46_L	66_I	1.545	0.94
71_G	74_V	1.533	0.94
21_D	25_T	1.528	0.94
39_A	84_L	1.519	0.93
14_E	29_Y	1.476	0.92
28_Y	110_A	1.455	0.92
87_H	113_L	1.438	0.91
17_A	27_H	1.407	0.91
46_L	74_V	1.399	0.90
59_L	81_V	1.375	0.89
114_V	118_E	1.344	0.88
50_G	66_I	1.327	0.88
18_T	30_A	1.307	0.87
18_T	34_W	1.240	0.84
74_V	123_W	1.198	0.82
35_A	117_A	1.192	0.81
9_L	45_A	1.180	0.81
106_S	109_D	1.172	0.80
38_A	114_V	1.170	0.80
12_A	42_A	1.151	0.79
41_K	94_P	1.150	0.79
115_K	119_K	1.148	0.79
22_T	30_A	1.145	0.79
85_T	88_Y	1.143	0.79
18_T	27_H	1.135	0.78
59_L	85_T	1.123	0.77
83_K	112_E	1.115	0.77
35_A	115_K	1.098	0.76
10_R	103_S	1.078	0.74
32_A	113_L	1.073	0.74
84_L	117_A	1.051	0.72
85_T	90_I	1.043	0.72
33_F	88_Y	1.030	0.71
19_A	35_A	1.030	0.71
23_I	110_A	1.024	0.70
15_D	22_T	0.985	0.67
44_K	57_H	0.974	0.67
16_L	117_A	0.971	0.66
122_E	126_R	0.970	0.66
118_E	122_E	0.955	0.65
7_K	34_W	0.921	0.62
80_E	119_K	0.905	0.61
23_I	32_A	0.903	0.61
77_I	120_V	0.889	0.59
14_E	22_T	0.887	0.59
17_A	20_K	0.874	0.58
33_F	92_R	0.860	0.57
41_K	55_R	0.859	0.57
5_A	12_A	0.847	0.56
22_T	41_K	0.847	0.56
39_A	120_V	0.843	0.55
23_I	114_V	0.835	0.55
114_V	121_I	0.822	0.53
23_I	107_K	0.821	0.53
7_K	48_I	0.820	0.53
47_L	66_I	0.811	0.52
109_D	113_L	0.809	0.52
47_L	62_L	0.790	0.51
14_E	104_L	0.782	0.50
14_E	30_A	0.781	0.50
15_D	94_P	0.781	0.50
20_K	114_V	0.779	0.50
109_D	116_K	0.778	0.49
39_A	81_V	0.775	0.49
31_S	110_A	0.768	0.49
47_L	109_D	0.766	0.48
77_I	81_V	0.752	0.47
112_E	115_K	0.751	0.47
27_H	33_F	0.740	0.46
36_E	110_A	0.737	0.46
32_A	109_D	0.736	0.46
63_L	73_S	0.736	0.46
111_E	115_K	0.736	0.46
88_Y	96_A	0.734	0.46
20_K	24_T	0.732	0.45
19_A	114_V	0.728	0.45
33_F	89_T	0.724	0.45
88_Y	91_S	0.722	0.44
9_L	125_K	0.698	0.42
15_D	18_T	0.697	0.42
28_Y	31_S	0.690	0.42
90_I	95_D	0.686	0.41
34_W	41_K	0.684	0.41
47_L	52_K	0.677	0.40
33_F	39_A	0.669	0.40
68_E	76_E	0.668	0.40
51_G	85_T	0.663	0.39
83_K	113_L	0.655	0.39
7_K	56_T	0.652	0.38
47_L	65_I	0.651	0.38
38_A	121_I	0.648	0.38
11_Q	102_Y	0.648	0.38
46_L	71_G	0.647	0.38
63_L	77_I	0.634	0.37
36_E	87_H	0.633	0.37
16_L	20_K	0.630	0.36
87_H	91_S	0.625	0.36
8_W	93_Y	0.621	0.36
12_A	79_S	0.617	0.35
12_A	38_A	0.617	0.35
105_Y	113_L	0.616	0.35
80_E	83_K	0.614	0.35
51_G	117_A	0.613	0.35
11_Q	54_E	0.612	0.35
5_A	49_A	0.610	0.35
40_E	57_H	0.609	0.35
59_L	86_L	0.608	0.35
57_H	93_Y	0.598	0.34
40_E	94_P	0.598	0.34
37_Q	84_L	0.595	0.34
38_A	68_E	0.594	0.33
86_L	106_S	0.594	0.33
83_K	87_H	0.588	0.33
14_E	27_H	0.588	0.33
46_L	124_V	0.587	0.33
16_L	51_G	0.581	0.32
27_H	30_A	0.578	0.32
64_E	83_K	0.567	0.31
93_Y	126_R	0.567	0.31
46_L	79_S	0.566	0.31
56_T	90_I	0.562	0.31
85_T	89_T	0.559	0.31
43_L	56_T	0.558	0.31
6_E	23_I	0.556	0.30
121_I	125_K	0.549	0.30
67_K	74_V	0.547	0.30
10_R	73_S	0.546	0.30
97_A	104_L	0.544	0.30
71_G	108_E	0.543	0.29
81_V	85_T	0.542	0.29
27_H	34_W	0.540	0.29
32_A	87_H	0.539	0.29
10_R	118_E	0.536	0.29
66_I	74_V	0.534	0.29
89_T	97_A	0.532	0.29
56_T	66_I	0.531	0.29
82_I	105_Y	0.531	0.29
76_E	120_V	0.530	0.29
38_A	75_E	0.526	0.28
81_V	120_V	0.525	0.28
85_T	104_L	0.525	0.28
75_E	108_E	0.524	0.28
66_I	123_W	0.524	0.28
50_G	91_S	0.524	0.28
41_K	48_I	0.523	0.28
80_E	112_E	0.523	0.28
8_W	94_P	0.514	0.27
108_E	120_V	0.510	0.27
28_Y	33_F	0.508	0.27
43_L	60_N	0.503	0.27
66_I	71_G	0.502	0.26
6_E	107_K	0.501	0.26
32_A	37_Q	0.501	0.26
36_E	94_P	0.500	0.26
27_H	31_S	0.500	0.26

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1ufbA	3	0.9767	100	0.264	Contact Map
3o10A	2	0.9922	100	0.272	Contact Map
1wolA	1	0.938	100	0.297	Contact Map
1o3uA	2	0.907	100	0.336	Contact Map
4nqfA	2	0.9457	100	0.351	Contact Map
2hsbA	2	0.9302	99.9	0.399	Contact Map
2jpuA	1	0.8682	91.3	0.87	Contact Map
1knyA	2	0.845	40.1	0.916	Contact Map
3mfnA	2	0.8992	33.8	0.919	Contact Map
4hpqC	2	0.9457	25.1	0.924	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0063 seconds.