Q97XR5 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97XR5 - Uncharacterized protein

UniProt:	Q97XR5	Sequences: MLEDVIDPETNYSIVKMGFIRNIEIEEGKIKVTLSPPTFWCPPLFLYMILEDVKRKLSESYNGVLIQVVDHHDAEKLTSCINNGKSFEECYKNEVEGNSYEAIRERFRVKRERDDRLSKLTLSINGEFCRLIYEAKRK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	138 (124)
Sequences:	154 (99)
Seq/√Len:	8.9

SULSO - Q97XR5

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
57_L	61_Y	4.331	0.99
44_L	100_Y	2.798	0.87
40_W	86_S	2.564	0.81
19_F	107_F	2.201	0.70
48_M	82_N	2.101	0.66
32_V	51_E	2.006	0.62
40_W	113_R	1.996	0.62
27_E	62_N	1.957	0.60
33_T	69_V	1.931	0.59
14_I	53_V	1.851	0.56
34_L	40_W	1.842	0.55
46_L	68_V	1.805	0.54
43_P	53_V	1.789	0.53
114_D	121_T	1.768	0.52
51_E	56_K	1.768	0.52
3_E	60_S	1.749	0.51
17_M	77_L	1.746	0.51
16_K	25_I	1.724	0.50
34_L	116_R	1.723	0.50
57_L	98_N	1.691	0.49
28_G	62_N	1.633	0.46
70_D	103_I	1.588	0.44
40_W	72_H	1.549	0.43
49_I	80_C	1.505	0.41
25_I	57_L	1.483	0.40
56_K	82_N	1.471	0.40
30_I	61_Y	1.461	0.39
121_T	125_N	1.439	0.38
34_L	72_H	1.405	0.37
39_F	73_D	1.380	0.36
21_R	116_R	1.375	0.36
82_N	95_V	1.375	0.36
29_K	63_G	1.350	0.35
59_E	97_G	1.343	0.34
76_K	94_E	1.329	0.34
44_L	107_F	1.317	0.33
47_Y	115_D	1.313	0.33
20_I	48_M	1.311	0.33
55_R	84_G	1.295	0.33
22_N	74_A	1.293	0.32
43_P	112_E	1.234	0.30
35_S	48_M	1.231	0.30
52_D	77_L	1.230	0.30
66_I	83_N	1.226	0.30
50_L	81_I	1.221	0.30
42_P	50_L	1.216	0.30
73_D	90_C	1.210	0.29
32_V	43_P	1.207	0.29
51_E	55_R	1.179	0.28
50_L	61_Y	1.165	0.28
29_K	75_E	1.155	0.27
35_S	44_L	1.145	0.27
40_W	85_K	1.141	0.27
54_K	60_S	1.140	0.27
4_D	56_K	1.127	0.27
32_V	53_V	1.125	0.26
50_L	118_S	1.112	0.26
85_K	89_E	1.087	0.25
36_P	46_L	1.076	0.25
76_K	87_F	1.076	0.25
67_Q	87_F	1.074	0.25
24_E	29_K	1.065	0.24
23_I	93_N	1.056	0.24
14_I	43_P	1.053	0.24
111_R	120_L	1.049	0.24
64_V	100_Y	1.033	0.23
48_M	107_F	1.018	0.23
59_E	63_G	1.017	0.23
4_D	60_S	1.014	0.23
111_R	114_D	1.013	0.23
76_K	81_I	1.003	0.23
42_P	77_L	0.994	0.22
114_D	125_N	0.967	0.21
31_K	122_L	0.966	0.21
34_L	97_G	0.965	0.21
18_G	70_D	0.960	0.21
13_S	103_I	0.955	0.21
91_Y	94_E	0.955	0.21
11_N	78_T	0.954	0.21
59_E	124_I	0.947	0.21
24_E	122_L	0.943	0.21
35_S	107_F	0.939	0.21
19_F	44_L	0.937	0.21
119_K	125_N	0.931	0.20
48_M	51_E	0.921	0.20
105_E	124_I	0.905	0.20
114_D	117_L	0.903	0.20
36_P	49_I	0.899	0.20
54_K	84_G	0.895	0.19
6_I	101_E	0.873	0.19
56_K	104_R	0.867	0.19
52_D	90_C	0.849	0.18
27_E	59_E	0.847	0.18
11_N	49_I	0.847	0.18
39_F	72_H	0.842	0.18
80_C	83_N	0.838	0.18
53_V	72_H	0.831	0.18
52_D	121_T	0.826	0.18
58_S	98_N	0.815	0.17
102_A	106_R	0.813	0.17
38_T	45_F	0.813	0.17
32_V	57_L	0.812	0.17
60_S	99_S	0.804	0.17
11_N	44_L	0.800	0.17
35_S	78_T	0.797	0.17
69_V	98_N	0.779	0.17
79_S	83_N	0.774	0.16
26_E	29_K	0.773	0.16
77_L	90_C	0.770	0.16
52_D	109_V	0.767	0.16
49_I	78_T	0.764	0.16
22_N	85_K	0.763	0.16
69_V	87_F	0.758	0.16
30_I	92_K	0.753	0.16
65_L	125_N	0.752	0.16
87_F	117_L	0.746	0.16
12_Y	98_N	0.739	0.16
44_L	78_T	0.738	0.16
15_V	35_S	0.735	0.15
5_V	9_E	0.734	0.15
5_V	8_P	0.734	0.15
57_L	102_A	0.714	0.15
84_G	108_R	0.711	0.15
25_I	31_K	0.710	0.15
111_R	116_R	0.710	0.15
47_Y	84_G	0.702	0.15
81_I	87_F	0.698	0.15
21_R	34_L	0.689	0.14
73_D	94_E	0.688	0.14
3_E	20_I	0.687	0.14
115_D	119_K	0.687	0.14
30_I	57_L	0.687	0.14
48_M	92_K	0.680	0.14
68_V	79_S	0.678	0.14
24_E	108_R	0.677	0.14
39_F	87_F	0.677	0.14
36_P	80_C	0.676	0.14
18_G	109_V	0.673	0.14
84_G	89_E	0.672	0.14
34_L	53_V	0.669	0.14
18_G	28_G	0.662	0.14
64_V	79_S	0.661	0.14
70_D	116_R	0.647	0.14
80_C	95_V	0.640	0.13
51_E	99_S	0.639	0.13
68_V	78_T	0.633	0.13
72_H	95_V	0.627	0.13
27_E	65_L	0.626	0.13
27_E	84_G	0.624	0.13
36_P	68_V	0.616	0.13
22_N	33_T	0.614	0.13
107_F	115_D	0.613	0.13
2_L	9_E	0.605	0.13
2_L	8_P	0.605	0.13
2_L	7_D	0.605	0.13
2_L	5_V	0.605	0.13
52_D	100_Y	0.604	0.13
87_F	99_S	0.590	0.12
27_E	76_K	0.590	0.12
56_K	61_Y	0.580	0.12
40_W	53_V	0.578	0.12
28_G	63_G	0.573	0.12
45_F	110_K	0.570	0.12
64_V	98_N	0.569	0.12
13_S	66_I	0.562	0.12
15_V	107_F	0.561	0.12
19_F	100_Y	0.561	0.12
20_I	85_K	0.559	0.12
46_L	70_D	0.556	0.12
12_Y	20_I	0.551	0.12
30_I	76_K	0.546	0.12
3_E	23_I	0.544	0.12
87_F	113_R	0.540	0.12
40_W	54_K	0.533	0.11
11_N	77_L	0.530	0.11
111_R	119_K	0.529	0.11
15_V	44_L	0.525	0.11
6_I	74_A	0.525	0.11
21_R	111_R	0.519	0.11
4_D	101_E	0.519	0.11
26_E	120_L	0.517	0.11
81_I	99_S	0.515	0.11
27_E	83_N	0.503	0.11
6_I	50_L	0.501	0.11
45_F	49_I	0.501	0.11
3_E	58_S	0.500	0.11

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3ux2A	2	0.7029	99.3	0.778	Contact Map
3cq1A	2	0.6087	99.1	0.797	Contact Map
3lnoA	1	0.6304	99	0.803	Contact Map
1uwdA	1	0.6159	98.9	0.811	Contact Map
4p3xA	1	0.587	13.3	0.955	Contact Map
4gnxA	1	0.6014	11.1	0.957	Contact Map
2pi2E	1	0.6594	10.5	0.957	Contact Map
1y8xB	1	0.2899	10.4	0.957	Contact Map
4xfdA	1	0.4855	9.4	0.958	Contact Map
3udcA	3	0.4928	7.9	0.959	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0065 seconds.