Q97XQ5 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97XQ5 - Helicase of the snf2/rad54 family (Carboxy end), hypothetical

UniProt:	Q97XQ5	Sequences: MRTLPDDIISKFQNNPSVKFIVLSVKAGGFGINLTSANRVIHFDRWWNPAVEDQATDRVYRIGQTRNVIVHKLISVGTLEEKIDQLLAFKRSLFKDIISSGDSWITELSTEELRKVIELSVGGY	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	124 (114)
Sequences:	6891 (3864)
Seq/√Len:	361.9

ECOLI - RAPA
BACSU - YWQA YQHH
HALSA - O52003 Q9HMW5 RAD25
SULSO - Q97XQ5 Q97ZF9

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
13_Q	36_S	4.720	1.00
42_H	56_T	3.068	1.00
4_L	7_D	3.017	1.00
53_D	91_R	2.957	1.00
40_V	59_V	2.768	1.00
6_D	10_S	2.713	1.00
10_S	14_N	2.301	1.00
56_T	70_V	2.220	1.00
52_E	72_K	2.144	1.00
15_N	18_V	2.143	1.00
39_R	69_I	2.139	1.00
23_L	28_G	2.137	1.00
8_I	21_I	2.059	1.00
7_D	11_K	2.046	1.00
110_T	114_R	2.044	1.00
109_S	112_E	2.021	1.00
9_I	13_Q	1.970	1.00
75_S	78_T	1.903	1.00
39_R	71_H	1.902	1.00
4_L	8_I	1.839	1.00
38_N	66_R	1.760	1.00
59_V	68_V	1.724	1.00
24_S	27_A	1.711	1.00
26_K	46_W	1.698	1.00
46_W	51_V	1.650	1.00
11_K	18_V	1.529	1.00
57_D	60_Y	1.514	1.00
74_I	84_D	1.500	1.00
26_K	51_V	1.491	1.00
41_I	73_L	1.463	1.00
92_S	96_D	1.447	1.00
11_K	15_N	1.432	1.00
84_D	87_L	1.418	1.00
45_R	87_L	1.379	1.00
82_K	85_Q	1.378	1.00
9_I	32_I	1.372	1.00
84_D	88_A	1.359	1.00
111_E	114_R	1.317	1.00
89_F	92_S	1.313	1.00
91_R	95_K	1.295	1.00
85_Q	89_F	1.272	1.00
7_D	10_S	1.245	1.00
112_E	115_K	1.236	1.00
8_I	11_K	1.204	1.00
46_W	52_E	1.193	1.00
88_A	91_R	1.171	1.00
88_A	92_S	1.134	1.00
76_V	81_E	1.118	1.00
53_D	56_T	1.099	1.00
25_V	46_W	1.079	1.00
82_K	86_L	1.078	1.00
108_L	112_E	1.056	1.00
25_V	55_A	1.009	1.00
53_D	57_D	1.001	1.00
37_A	59_V	0.994	1.00
25_V	52_E	0.975	1.00
23_L	27_A	0.974	1.00
6_D	13_Q	0.969	1.00
9_I	36_S	0.955	1.00
49_P	52_E	0.932	1.00
86_L	89_F	0.910	1.00
12_F	37_A	0.902	1.00
81_E	85_Q	0.900	1.00
50_A	91_R	0.892	1.00
28_G	32_I	0.882	1.00
109_S	115_K	0.871	1.00
45_R	84_D	0.867	1.00
94_F	99_S	0.863	1.00
103_S	113_L	0.840	1.00
47_W	87_L	0.828	1.00
13_Q	35_T	0.815	1.00
3_T	7_D	0.812	1.00
85_Q	88_A	0.810	1.00
59_V	70_V	0.807	1.00
14_N	17_S	0.805	1.00
6_D	9_I	0.805	1.00
13_Q	33_N	0.802	1.00
94_F	98_I	0.802	1.00
42_H	45_R	0.799	1.00
14_N	18_V	0.793	1.00
100_S	104_W	0.785	1.00
42_H	72_K	0.781	1.00
38_N	65_T	0.780	1.00
50_A	94_F	0.778	1.00
6_D	67_N	0.778	1.00
45_R	72_K	0.773	1.00
31_G	68_V	0.763	1.00
24_S	44_D	0.752	1.00
104_W	107_E	0.743	1.00
40_V	70_V	0.735	1.00
39_R	66_R	0.735	1.00
23_L	33_N	0.734	1.00
58_R	61_R	0.732	1.00
111_E	115_K	0.727	1.00
49_P	91_R	0.722	1.00
109_S	113_L	0.710	0.99
72_K	87_L	0.708	0.99
41_I	71_H	0.688	0.99
94_F	97_I	0.685	0.99
46_W	86_L	0.683	0.99
105_I	110_T	0.679	0.99
108_L	115_K	0.676	0.99
96_D	99_S	0.675	0.99
105_I	108_L	0.674	0.99
95_K	99_S	0.666	0.99
44_D	80_E	0.658	0.99
74_I	81_E	0.642	0.99
4_L	11_K	0.635	0.99
21_I	27_A	0.632	0.99
107_E	112_E	0.626	0.99
113_L	116_V	0.625	0.99
50_A	53_D	0.620	0.99
47_W	86_L	0.614	0.98
97_I	101_G	0.613	0.98
15_N	19_K	0.611	0.98
103_S	106_T	0.608	0.98
103_S	109_S	0.598	0.98
103_S	107_E	0.585	0.98
83_I	86_L	0.584	0.98
56_T	60_Y	0.584	0.98
83_I	87_L	0.581	0.98
11_K	16_P	0.575	0.98
102_D	105_I	0.573	0.98
102_D	107_E	0.573	0.98
3_T	10_S	0.572	0.97
23_L	46_W	0.571	0.97
74_I	82_K	0.570	0.97
44_D	72_K	0.570	0.97
40_V	56_T	0.570	0.97
44_D	73_L	0.558	0.97
105_I	114_R	0.557	0.97
110_T	115_K	0.556	0.97
23_L	32_I	0.555	0.97
46_W	72_K	0.555	0.97
38_N	67_N	0.548	0.97
57_D	62_I	0.548	0.97
46_W	62_I	0.547	0.97
21_I	34_L	0.546	0.97
33_N	62_I	0.544	0.97
45_R	79_L	0.542	0.97
30_F	57_D	0.540	0.96
29_G	51_V	0.540	0.96
24_S	75_S	0.538	0.96
11_K	14_N	0.534	0.96
37_A	62_I	0.529	0.96
40_V	62_I	0.529	0.96
45_R	56_T	0.528	0.96
22_V	45_R	0.527	0.96
27_A	101_G	0.527	0.96
87_L	94_F	0.522	0.96
46_W	55_A	0.519	0.96
107_E	115_K	0.519	0.96
12_F	19_K	0.518	0.96
52_E	87_L	0.516	0.95
60_Y	67_N	0.516	0.95
106_T	113_L	0.516	0.95
107_E	114_R	0.515	0.95
47_W	98_I	0.514	0.95
109_S	114_R	0.512	0.95
42_H	49_P	0.512	0.95
23_L	34_L	0.511	0.95
29_G	57_D	0.510	0.95
55_A	72_K	0.510	0.95
45_R	52_E	0.506	0.95
5_P	27_A	0.505	0.95
96_D	111_E	0.505	0.95
32_I	35_T	0.505	0.95
19_K	86_L	0.503	0.95
105_I	109_S	0.501	0.95
12_F	21_I	0.500	0.95
10_S	110_T	0.500	0.95

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1z63A	1	0.9435	100	0.297	Contact Map
1z3iX	4	1	100	0.298	Contact Map
1z5zA	1	0.8871	100	0.305	Contact Map
3mwyW	2	0.9194	100	0.315	Contact Map
3hgtA	2	0.8226	100	0.361	Contact Map
3dmqA	1	0.9839	99.9	0.505	Contact Map
4ernA	1	0.9919	99.8	0.521	Contact Map
2ykgA	1	0.7097	99.8	0.539	Contact Map
4a2wA	1	0.7097	99.8	0.548	Contact Map
4a2qA	1	0.7016	99.8	0.552	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0063 seconds.