Q97XQ1 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97XQ1 - First ORF in transposon ISC1904

UniProt:	Q97XQ1	Sequences: MLRPKEVCQRLGISYPTLREYVKKGYIKPVILQSGKWRFNEEDVEKLMGIVKRRKVVLYARVSSKQKDELVNQVKYLEEQVKEYDLVITDIGSGLNMKRKGFLKLLRMILNNEVSRVVIAYPDRLVRFGFEILEETCKAHGCEIVVLNQEDKTPEEELVEDLVSVLVSFSEKLYGMRSHKYEKVKKCAEELKN	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	193 (183)
Sequences:	475 (332)
Seq/√Len:	24.5

SULSO - Q97XQ1 Q97UQ9 Q97XI0 Q97XZ4 Q97U52 Q97U67 Q97XB5 Q97YH2 Q97YU0 Q97YI6 Q97YX0 Q97X40 Q97Z60 Q97X25 Q97WZ6

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
56_V	116_R	4.160	1.00
60_A	77_L	4.077	1.00
81_V	118_V	3.737	1.00
116_R	143_E	3.507	1.00
58_L	147_L	2.852	1.00
7_V	11_L	2.785	0.99
102_F	125_L	2.739	0.99
109_I	137_C	2.554	0.99
17_T	21_Y	2.433	0.98
90_D	101_G	2.400	0.98
13_I	21_Y	2.396	0.98
5_K	9_Q	2.355	0.98
134_E	138_K	2.300	0.98
84_Y	145_V	2.203	0.97
110_L	140_H	2.191	0.97
105_L	114_V	2.138	0.96
16_P	19_R	2.127	0.96
18_L	39_F	2.074	0.96
74_V	87_V	2.068	0.96
97_M	131_E	1.922	0.93
22_V	37_W	1.914	0.93
118_V	131_E	1.913	0.93
58_L	77_L	1.872	0.92
3_R	34_S	1.838	0.92
74_V	89_T	1.767	0.90
55_K	108_M	1.728	0.89
95_L	128_F	1.713	0.89
76_Y	120_A	1.705	0.88
130_F	144_I	1.659	0.87
88_I	101_G	1.657	0.87
126_V	130_F	1.648	0.86
109_I	117_V	1.637	0.86
137_C	142_C	1.616	0.85
109_I	114_V	1.606	0.85
109_I	119_I	1.602	0.85
16_P	24_K	1.584	0.84
130_F	146_V	1.539	0.82
58_L	87_V	1.537	0.82
22_V	29_P	1.535	0.82
26_Y	33_Q	1.493	0.80
4_P	19_R	1.483	0.80
12_G	141_G	1.470	0.79
57_V	74_V	1.459	0.79
97_M	168_S	1.459	0.79
108_M	113_E	1.433	0.78
40_N	43_D	1.408	0.76
167_V	178_S	1.370	0.74
31_I	37_W	1.349	0.73
168_S	171_E	1.343	0.73
156_E	160_E	1.335	0.72
118_V	145_V	1.331	0.72
17_T	20_E	1.322	0.72
95_L	129_G	1.316	0.71
137_C	173_L	1.313	0.71
62_V	66_Q	1.312	0.71
7_V	27_I	1.287	0.69
14_S	20_E	1.269	0.68
27_I	30_V	1.262	0.68
71_V	75_K	1.254	0.67
69_E	72_N	1.245	0.67
94_G	125_L	1.233	0.66
167_V	171_E	1.207	0.64
106_L	110_L	1.196	0.64
4_P	18_L	1.196	0.64
8_C	13_I	1.189	0.63
22_V	39_F	1.179	0.62
75_K	78_E	1.176	0.62
56_V	143_E	1.174	0.62
90_D	168_S	1.168	0.62
58_L	81_V	1.151	0.61
7_V	44_V	1.148	0.60
66_Q	69_E	1.138	0.60
20_E	23_K	1.135	0.59
120_A	179_H	1.128	0.59
121_Y	160_E	1.124	0.59
171_E	176_M	1.117	0.58
15_Y	19_R	1.105	0.57
22_V	27_I	1.100	0.57
88_I	117_V	1.089	0.56
8_C	15_Y	1.080	0.56
3_R	38_R	1.078	0.55
121_Y	152_K	1.076	0.55
160_E	171_E	1.065	0.55
67_K	180_K	1.043	0.53
56_V	118_V	1.042	0.53
57_V	88_I	1.035	0.52
77_L	147_L	1.031	0.52
88_I	105_L	1.021	0.51
116_R	145_V	1.020	0.51
94_G	102_F	1.017	0.51
62_V	70_L	1.016	0.51
74_V	106_L	1.007	0.50
28_K	43_D	1.004	0.50
81_V	84_Y	1.000	0.50
157_E	169_F	0.998	0.50
8_C	18_L	0.987	0.49
90_D	120_A	0.981	0.49
130_F	133_L	0.981	0.49
126_V	133_L	0.979	0.48
63_S	66_Q	0.976	0.48
165_V	175_G	0.975	0.48
171_E	178_S	0.959	0.47
27_I	43_D	0.955	0.47
174_Y	177_R	0.947	0.46
56_V	92_G	0.939	0.46
66_Q	72_N	0.918	0.44
152_K	172_K	0.915	0.44
4_P	15_Y	0.914	0.44
13_I	20_E	0.911	0.44
80_Q	145_V	0.910	0.43
4_P	29_P	0.908	0.43
7_V	18_L	0.896	0.42
54_R	141_G	0.895	0.42
48_M	51_V	0.888	0.42
109_I	142_C	0.884	0.42
3_R	33_Q	0.874	0.41
11_L	18_L	0.870	0.41
26_Y	34_S	0.863	0.40
43_D	46_K	0.862	0.40
137_C	170_S	0.847	0.39
39_F	43_D	0.845	0.39
128_F	161_D	0.841	0.39
7_V	38_R	0.838	0.38
76_Y	148_N	0.835	0.38
19_R	22_V	0.832	0.38
27_I	133_L	0.831	0.38
42_E	72_N	0.828	0.38
90_D	184_V	0.826	0.38
64_S	72_N	0.824	0.38
19_R	39_F	0.820	0.37
18_L	22_V	0.816	0.37
156_E	159_V	0.813	0.37
117_V	144_I	0.806	0.36
22_V	31_I	0.797	0.36
158_L	167_V	0.797	0.36
72_N	163_V	0.797	0.36
147_L	155_E	0.792	0.35
6_E	145_V	0.788	0.35
69_E	120_A	0.785	0.35
162_L	175_G	0.785	0.35
106_L	145_V	0.783	0.35
5_K	34_S	0.781	0.35
71_V	74_V	0.780	0.35
14_S	173_L	0.778	0.34
162_L	166_L	0.778	0.34
71_V	185_K	0.768	0.34
117_V	146_V	0.766	0.34
167_V	179_H	0.760	0.33
97_M	126_V	0.759	0.33
107_R	139_A	0.756	0.33
4_P	7_V	0.754	0.33
8_C	172_K	0.753	0.33
75_K	79_E	0.749	0.33
80_Q	148_N	0.740	0.32
6_E	43_D	0.736	0.32
44_V	117_V	0.735	0.32
78_E	87_V	0.733	0.32
92_G	164_S	0.730	0.31
152_K	160_E	0.727	0.31
57_V	105_L	0.724	0.31
159_V	162_L	0.719	0.31
45_E	48_M	0.718	0.31
77_L	150_E	0.714	0.30
162_L	169_F	0.707	0.30
179_H	185_K	0.707	0.30
133_L	137_C	0.705	0.30
77_L	142_C	0.701	0.30
118_V	182_E	0.696	0.29
100_K	155_E	0.685	0.29
19_R	31_I	0.685	0.29
83_E	118_V	0.684	0.29
23_K	31_I	0.682	0.29
51_V	115_S	0.682	0.29
102_F	126_V	0.682	0.29
33_Q	112_N	0.667	0.28
99_R	126_V	0.667	0.28
72_N	75_K	0.664	0.27
119_I	144_I	0.662	0.27
63_S	127_R	0.659	0.27
46_K	121_Y	0.658	0.27
96_N	140_H	0.650	0.27
133_L	154_P	0.647	0.27
133_L	158_L	0.647	0.27
34_S	112_N	0.647	0.27
119_I	146_V	0.645	0.26
76_Y	164_S	0.643	0.26
4_P	8_C	0.641	0.26
161_D	175_G	0.639	0.26
120_A	167_V	0.638	0.26
98_K	172_K	0.637	0.26
86_L	99_R	0.635	0.26
19_R	37_W	0.634	0.26
110_L	136_T	0.632	0.26
13_I	31_I	0.628	0.25
30_V	38_R	0.627	0.25
158_L	169_F	0.625	0.25
92_G	143_E	0.622	0.25
151_D	166_L	0.619	0.25
64_S	175_G	0.619	0.25
128_F	165_V	0.619	0.25
54_R	142_C	0.616	0.25
6_E	158_L	0.615	0.25
178_S	181_Y	0.613	0.25
154_P	176_M	0.609	0.24
19_R	36_K	0.609	0.24
172_K	176_M	0.608	0.24
95_L	132_I	0.608	0.24
8_C	102_F	0.608	0.24
117_V	125_L	0.607	0.24
179_H	183_K	0.606	0.24
102_F	168_S	0.604	0.24
21_Y	38_R	0.603	0.24
57_V	114_V	0.602	0.24
80_Q	84_Y	0.600	0.24
44_V	48_M	0.597	0.24
31_I	36_K	0.596	0.24
103_L	133_L	0.594	0.24
39_F	44_V	0.591	0.24
14_S	22_V	0.588	0.23
92_G	153_T	0.587	0.23
125_L	132_I	0.582	0.23
3_R	36_K	0.581	0.23
102_F	115_S	0.580	0.23
76_Y	179_H	0.571	0.22
9_Q	67_K	0.569	0.22
119_I	161_D	0.569	0.22
118_V	135_E	0.568	0.22
129_G	170_S	0.567	0.22
146_V	166_L	0.566	0.22
162_L	165_V	0.566	0.22
145_V	151_D	0.565	0.22
128_F	175_G	0.563	0.22
33_Q	44_V	0.563	0.22
13_I	16_P	0.561	0.22
170_S	176_M	0.557	0.22
158_L	161_D	0.555	0.22
22_V	32_L	0.553	0.22
91_I	99_R	0.550	0.21
80_Q	147_L	0.549	0.21
10_R	14_S	0.549	0.21
6_E	57_V	0.546	0.21
126_V	164_S	0.546	0.21
15_Y	37_W	0.546	0.21
5_K	8_C	0.544	0.21
98_K	140_H	0.544	0.21
122_P	166_L	0.541	0.21
58_L	148_N	0.537	0.21
91_I	144_I	0.536	0.21
153_T	179_H	0.533	0.21
136_T	139_A	0.533	0.21
5_K	25_G	0.533	0.21
13_I	18_L	0.532	0.21
138_K	172_K	0.526	0.20
119_I	143_E	0.526	0.20
127_R	174_Y	0.518	0.20
20_E	29_P	0.518	0.20
10_R	89_T	0.516	0.20
88_I	103_L	0.515	0.20
16_P	20_E	0.513	0.20
55_K	113_E	0.513	0.20
161_D	165_V	0.513	0.20
65_K	120_A	0.511	0.20
6_E	10_R	0.511	0.20
76_Y	90_D	0.511	0.20
12_G	128_F	0.510	0.20
123_D	127_R	0.508	0.20
99_R	154_P	0.507	0.19
148_N	151_D	0.507	0.19
10_R	144_I	0.504	0.19
96_N	105_L	0.504	0.19
29_P	69_E	0.503	0.19
117_V	151_D	0.502	0.19
111_N	151_D	0.500	0.19
23_K	100_K	0.500	0.19

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3ilxA	2	0.7202	100	0.65	Contact Map
3lhkA	2	0.7306	100	0.659	Contact Map
3g13A	2	0.715	99.8	0.744	Contact Map
3bvpA	4	0.6269	99.8	0.75	Contact Map
3guvA	2	0.6943	99.8	0.754	Contact Map
2mhcA	1	0.5544	99.8	0.758	Contact Map
4bqqA	2	0.6839	99.8	0.759	Contact Map
2gm5A	4	0.6218	99.7	0.766	Contact Map
3pkzA	4	0.5751	99.7	0.771	Contact Map
1gdtA	2	0.6891	99.7	0.771	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0078 seconds.