Q97XP7 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97XP7 - Uncharacterized protein

UniProt:	Q97XP7	Sequences: MSWEEVFRNYLDDKDIRILKLLNQDANISDAKLGKLVGLSKTAVRLRRVKLQNSGILKIVGVVVLQNLGIPYADLLVKLKNDIVLREQFINKLIANDLVYEVTEYMGDWDLLIRLFHNNIAKLKDESLKIISDKAVQDYRISYVVKTYKAWGKSILSSI	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	159 (139)
Sequences:	13422 (8821)
Seq/√Len:	748.2

ECOLI - LRP ASNC YBAO
BACSU - AZLB YWRC YUGG LRPC LRPB YEZC LRPA
HALSA - Q9HNI1 Q9HQ33 Q9HQ13 Q9HQB6 Q9HP41 Q9HQG1 Q9HP70 Q9HNW8
SULSO - Q97XP7 Q7LXS6 Q7LX67 Q97W90 LYSM Q97X78 Q97VN7 Q980P3

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
52_Q	59_I	3.140	1.00
21_L	36_L	3.099	1.00
101_E	114_R	2.815	1.00
108_D	140_R	2.667	1.00
118_N	122_K	2.401	1.00
30_D	48_R	2.383	1.00
66_Q	121_A	2.295	1.00
15_D	47_R	2.180	1.00
50_K	54_S	2.175	1.00
21_L	28_I	2.164	1.00
58_K	64_V	2.156	1.00
14_K	39_L	1.874	1.00
58_K	62_V	1.867	1.00
100_Y	116_F	1.847	1.00
49_V	53_N	1.845	1.00
21_L	24_Q	1.787	1.00
96_N	126_E	1.770	1.00
125_D	129_K	1.767	1.00
39_L	43_A	1.761	1.00
80_K	137_Q	1.723	1.00
31_A	35_K	1.690	1.00
85_L	88_Q	1.675	1.00
119_N	122_K	1.663	1.00
28_I	36_L	1.659	1.00
32_K	35_K	1.628	1.00
31_A	41_K	1.628	1.00
122_K	125_D	1.622	1.00
92_K	95_A	1.564	1.00
39_L	44_V	1.540	1.00
40_S	43_A	1.519	1.00
18_I	33_L	1.517	1.00
98_L	122_K	1.502	1.00
30_D	45_R	1.472	1.00
89_F	93_L	1.472	1.00
90_I	94_I	1.459	1.00
92_K	133_D	1.450	1.00
13_D	17_R	1.439	1.00
37_V	44_V	1.423	1.00
87_E	91_N	1.387	1.00
27_N	59_I	1.385	1.00
22_L	48_R	1.345	1.00
28_I	33_L	1.342	1.00
32_K	36_L	1.299	1.00
74_D	103_T	1.294	1.00
24_Q	36_L	1.292	1.00
14_K	17_R	1.278	1.00
49_V	52_Q	1.274	1.00
80_K	138_D	1.250	1.00
29_S	32_K	1.241	1.00
25_D	36_L	1.221	1.00
82_D	137_Q	1.221	1.00
124_K	146_K	1.211	1.00
90_I	146_K	1.207	1.00
70_I	118_N	1.188	1.00
21_L	33_L	1.171	1.00
14_K	37_V	1.150	1.00
12_D	47_R	1.143	1.00
17_R	21_L	1.110	1.00
74_D	114_R	1.109	1.00
28_I	32_K	1.096	1.00
102_V	113_I	1.079	1.00
96_N	130_I	1.075	1.00
26_A	59_I	1.074	1.00
17_R	20_K	1.056	1.00
117_H	122_K	1.044	1.00
88_Q	92_K	1.043	1.00
103_T	114_R	1.041	1.00
78_K	138_D	1.037	1.00
99_V	115_L	1.024	1.00
90_I	111_L	1.020	1.00
96_N	129_K	1.019	1.00
64_V	67_N	1.017	1.00
20_K	24_Q	1.017	1.00
91_N	94_I	1.016	1.00
105_Y	112_L	1.011	1.00
117_H	123_L	1.011	1.00
30_D	34_G	1.009	1.00
80_K	108_D	1.002	1.00
115_L	126_E	0.998	1.00
98_L	130_I	0.990	1.00
71_P	119_N	0.990	1.00
34_G	44_V	0.984	1.00
17_R	37_V	0.970	1.00
117_H	126_E	0.969	1.00
27_N	52_Q	0.946	1.00
124_K	128_L	0.938	1.00
73_A	120_I	0.937	1.00
41_K	45_R	0.919	1.00
30_D	41_K	0.918	1.00
91_N	95_A	0.914	1.00
31_A	45_R	0.910	1.00
75_L	115_L	0.901	1.00
103_T	144_V	0.901	1.00
99_V	102_V	0.900	1.00
45_R	49_V	0.899	1.00
78_K	142_S	0.891	1.00
65_L	116_F	0.886	1.00
51_L	56_I	0.869	1.00
34_G	39_L	0.868	1.00
104_E	128_L	0.862	1.00
11_L	16_I	0.853	1.00
99_V	113_I	0.847	1.00
79_L	113_I	0.846	1.00
83_I	86_R	0.845	1.00
88_Q	91_N	0.842	1.00
15_D	50_K	0.842	1.00
93_L	102_V	0.842	1.00
103_T	147_T	0.828	1.00
26_A	32_K	0.828	1.00
127_S	141_I	0.823	1.00
26_A	61_G	0.803	1.00
16_I	20_K	0.800	1.00
78_K	140_R	0.792	1.00
12_D	15_D	0.792	1.00
106_M	143_Y	0.791	1.00
18_I	47_R	0.788	1.00
42_T	46_L	0.784	1.00
33_L	44_V	0.781	1.00
108_D	138_D	0.781	1.00
78_K	109_W	0.780	1.00
77_V	113_I	0.775	1.00
109_W	140_R	0.769	1.00
18_I	44_V	0.755	1.00
76_L	112_L	0.754	1.00
92_K	96_N	0.743	1.00
87_E	90_I	0.737	1.00
121_A	124_K	0.734	1.00
56_I	67_N	0.731	1.00
18_I	28_I	0.716	1.00
21_L	25_D	0.715	1.00
70_I	98_L	0.710	1.00
33_L	48_R	0.707	1.00
89_F	111_L	0.703	1.00
126_E	130_I	0.694	1.00
11_L	56_I	0.693	1.00
25_D	28_I	0.693	1.00
13_D	16_I	0.686	1.00
73_A	81_N	0.685	1.00
76_L	142_S	0.682	1.00
46_L	49_V	0.670	1.00
98_L	126_E	0.669	1.00
70_I	116_F	0.667	1.00
105_Y	109_W	0.662	1.00
46_L	50_K	0.662	1.00
74_D	116_F	0.660	1.00
86_R	111_L	0.659	1.00
120_I	143_Y	0.658	1.00
81_N	86_R	0.656	1.00
121_A	125_D	0.656	1.00
18_I	21_L	0.654	1.00
15_D	51_L	0.654	1.00
87_E	128_L	0.651	1.00
93_L	113_I	0.648	1.00
88_Q	135_A	0.645	1.00
74_D	81_N	0.643	1.00
34_G	41_K	0.642	1.00
47_R	51_L	0.633	1.00
18_I	48_R	0.632	1.00
90_I	148_Y	0.631	1.00
78_K	108_D	0.618	1.00
128_L	132_S	0.617	1.00
63_V	68_L	0.617	1.00
81_N	89_F	0.614	1.00
30_D	44_V	0.614	1.00
23_N	60_V	0.608	1.00
18_I	51_L	0.604	1.00
126_E	131_I	0.604	1.00
74_D	144_V	0.604	1.00
19_L	51_L	0.601	1.00
127_S	139_Y	0.600	1.00
104_E	111_L	0.588	1.00
122_K	126_E	0.584	1.00
55_G	58_K	0.583	1.00
14_K	43_A	0.578	1.00
96_N	133_D	0.574	1.00
42_T	45_R	0.573	1.00
62_V	65_L	0.570	1.00
120_I	145_V	0.566	1.00
100_Y	114_R	0.566	1.00
64_V	68_L	0.562	1.00
82_D	85_L	0.554	1.00
105_Y	144_V	0.552	1.00
98_L	118_N	0.551	1.00
96_N	99_V	0.550	1.00
127_S	130_I	0.547	1.00
50_K	53_N	0.545	1.00
105_Y	142_S	0.545	1.00
76_L	144_V	0.541	1.00
37_V	43_A	0.539	1.00
115_L	123_L	0.538	1.00
80_K	109_W	0.536	1.00
20_K	23_N	0.531	1.00
74_D	112_L	0.526	1.00
92_K	134_K	0.523	1.00
24_Q	28_I	0.521	1.00
10_Y	54_S	0.519	1.00
31_A	34_G	0.519	1.00
71_P	121_A	0.516	1.00
85_L	134_K	0.516	1.00
29_S	34_G	0.514	1.00
16_I	23_N	0.513	1.00
126_E	129_K	0.508	1.00
104_E	124_K	0.508	1.00
108_D	142_S	0.505	1.00
25_D	32_K	0.505	1.00
76_L	103_T	0.505	1.00
19_L	63_V	0.503	1.00
94_I	102_V	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4ch7A	1	0.9245	100	0.179	Contact Map
4un1B	1	0.9371	100	0.209	Contact Map
4un1A	1	0.8868	100	0.244	Contact Map
2e1cA	1	0.9182	100	0.247	Contact Map
4pcqA	2	0.9182	100	0.249	Contact Map
2ia0A	2	0.9119	100	0.26	Contact Map
2p5vA	5	0.9623	100	0.264	Contact Map
2cg4A	6	0.9182	100	0.285	Contact Map
3i4pA	5	0.9245	100	0.288	Contact Map
2pn6A	5	0.9182	100	0.289	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0068 seconds.