Q97XN9 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97XN9 - Uncharacterized protein

UniProt:	Q97XN9	Sequences: MRYTDWMIQAEEDLDVARVLLEAGKYFAVTFYSQQAVEKALKSLLIHLGKDPGKTHSLTELASMIENEGLKIPQNIMEDLMVISPHFIISRYPDAANGVPARQYTKNMAEDLYRRAKEVLGWVKGNLQ	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	128 (115)
Sequences:	460 (422)
Seq/√Len:	39.4

SULSO - Q97XN9 Q97VT0 Q97XR7 Q97XB1

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
18_R	117_K	5.754	1.00
11_E	124_K	4.732	1.00
13_D	39_K	3.455	1.00
57_S	84_S	2.656	1.00
106_K	110_E	2.565	1.00
40_A	120_L	2.536	1.00
16_V	20_L	2.446	1.00
20_L	32_Y	2.378	1.00
86_H	104_Y	2.283	1.00
79_D	115_R	2.208	0.99
41_L	58_L	2.163	0.99
9_Q	27_F	2.067	0.99
28_A	32_Y	2.035	0.99
44_L	72_I	1.767	0.97
13_D	32_Y	1.749	0.97
62_A	80_L	1.728	0.97
44_L	65_I	1.618	0.95
114_R	117_K	1.608	0.95
7_M	40_A	1.598	0.95
72_I	122_W	1.548	0.94
26_Y	109_A	1.529	0.94
37_V	83_I	1.516	0.94
11_E	120_L	1.486	0.93
9_Q	104_Y	1.475	0.93
58_L	80_L	1.445	0.92
86_H	112_L	1.436	0.92
15_D	25_K	1.434	0.92
12_E	27_F	1.400	0.91
19_V	25_K	1.397	0.90
85_P	108_M	1.385	0.90
19_V	23_A	1.315	0.88
113_Y	117_K	1.307	0.87
36_A	113_Y	1.242	0.84
33_S	114_R	1.229	0.84
65_I	72_I	1.222	0.83
16_V	32_Y	1.164	0.80
48_L	65_I	1.155	0.80
33_S	116_A	1.151	0.79
16_V	25_K	1.144	0.79
8_I	102_R	1.143	0.79
105_T	108_M	1.128	0.78
7_M	43_S	1.111	0.77
39_K	93_P	1.106	0.77
82_V	111_D	1.095	0.76
10_A	40_A	1.078	0.75
13_D	20_L	1.069	0.74
17_A	33_S	1.066	0.74
58_L	84_S	1.065	0.74
16_V	28_A	1.064	0.74
20_L	28_A	1.057	0.73
121_G	125_G	1.055	0.73
62_A	72_I	1.047	0.73
76_I	119_V	1.031	0.71
31_F	87_F	1.028	0.71
117_K	121_G	1.001	0.69
83_I	116_A	0.986	0.68
114_R	118_E	0.982	0.68
12_E	20_L	0.960	0.66
76_I	80_L	0.959	0.66
84_S	87_F	0.947	0.65
30_T	112_L	0.947	0.65
34_Q	109_A	0.936	0.64
84_S	89_I	0.935	0.64
21_L	30_T	0.929	0.63
39_K	54_K	0.924	0.63
79_D	118_E	0.924	0.63
14_L	116_A	0.920	0.63
21_L	113_Y	0.919	0.62
21_L	109_A	0.918	0.62
45_L	108_M	0.900	0.61
86_H	90_S	0.880	0.59
7_M	124_K	0.870	0.58
18_R	113_Y	0.864	0.58
37_V	119_V	0.853	0.57
5_D	32_Y	0.836	0.55
32_Y	39_K	0.830	0.55
20_L	39_K	0.829	0.55
5_D	46_I	0.826	0.54
29_V	109_A	0.821	0.54
14_L	18_R	0.810	0.53
108_M	112_L	0.802	0.52
12_E	28_A	0.792	0.51
45_L	61_L	0.790	0.51
110_E	114_R	0.785	0.51
45_L	65_I	0.784	0.50
34_Q	86_H	0.778	0.50
108_M	115_R	0.778	0.50
7_M	120_L	0.776	0.50
44_L	70_L	0.765	0.49
49_G	84_S	0.763	0.49
104_Y	112_L	0.762	0.48
36_A	67_N	0.749	0.47
78_E	107_N	0.745	0.47
62_A	89_I	0.742	0.47
41_L	55_T	0.737	0.46
13_D	16_V	0.728	0.45
9_Q	53_G	0.723	0.45
21_L	106_K	0.721	0.45
12_E	103_Q	0.721	0.45
62_A	76_I	0.717	0.44
5_D	55_T	0.717	0.44
42_K	56_H	0.709	0.44
82_V	112_L	0.706	0.43
31_F	88_I	0.704	0.43
87_F	90_S	0.703	0.43
23_A	63_S	0.701	0.43
89_I	94_D	0.691	0.42
15_D	18_R	0.675	0.41
87_F	95_A	0.666	0.40
33_S	109_A	0.666	0.40
79_D	82_V	0.663	0.40
17_A	113_Y	0.662	0.39
55_T	65_I	0.660	0.39
44_L	78_E	0.660	0.39
113_Y	120_L	0.658	0.39
31_F	91_R	0.651	0.39
26_Y	31_F	0.650	0.38
111_D	114_R	0.642	0.38
84_S	88_I	0.633	0.37
10_A	93_P	0.629	0.37
6_W	92_Y	0.629	0.37
14_L	63_S	0.626	0.36
50_K	64_M	0.624	0.36
18_R	22_E	0.624	0.36
45_L	64_M	0.623	0.36
30_T	108_M	0.619	0.36
80_L	84_S	0.619	0.36
44_L	68_E	0.617	0.36
65_I	122_W	0.616	0.36
58_L	85_P	0.611	0.35
36_A	120_L	0.610	0.35
9_Q	101_A	0.610	0.35
13_D	93_P	0.608	0.35
30_T	90_S	0.607	0.35
10_A	36_A	0.600	0.34
25_K	28_A	0.592	0.34
32_Y	45_L	0.589	0.33
25_K	31_F	0.588	0.33
32_Y	46_I	0.587	0.33
12_E	25_K	0.587	0.33
37_V	80_L	0.582	0.33
25_K	32_Y	0.579	0.33
55_T	89_I	0.577	0.32
26_Y	29_V	0.577	0.32
84_S	103_Q	0.576	0.32
75_N	118_E	0.574	0.32
10_A	78_E	0.573	0.32
41_L	59_T	0.564	0.31
66_E	72_I	0.558	0.31
86_H	101_A	0.557	0.31
35_Q	83_I	0.548	0.30
80_L	119_V	0.547	0.30
35_Q	116_A	0.543	0.30
12_E	19_V	0.543	0.30
67_N	75_N	0.537	0.29
34_Q	87_F	0.531	0.29
39_K	46_I	0.530	0.29
10_A	85_P	0.529	0.29
44_L	48_L	0.528	0.29
65_I	70_L	0.527	0.29
6_W	41_L	0.525	0.28
74_Q	77_M	0.524	0.28
20_L	61_L	0.523	0.28
11_E	77_M	0.521	0.28
67_N	71_K	0.515	0.28
114_R	123_V	0.513	0.28
56_H	61_L	0.512	0.27
48_L	90_S	0.507	0.27
9_Q	28_A	0.507	0.27
39_K	51_D	0.504	0.27
27_F	95_A	0.504	0.27
30_T	87_F	0.500	0.27

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3o10A	2	0.9922	100	0.283	Contact Map
1ufbA	3	0.9766	100	0.284	Contact Map
1wolA	1	0.9375	100	0.315	Contact Map
1o3uA	2	0.9141	100	0.318	Contact Map
4nqfA	2	0.9531	100	0.35	Contact Map
2hsbA	2	0.9297	99.9	0.418	Contact Map
2jpuA	1	0.8828	87.2	0.88	Contact Map
3mfnA	2	0.9062	43.5	0.914	Contact Map
1knyA	2	0.8516	39.6	0.916	Contact Map
4wuyA	1	0.8828	26.3	0.924	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0061 seconds.