Q97XN3 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97XN3 - Partial transposase in ISC1316

UniProt:	Q97XN3	Sequences: MIVHRDFPLDKVKRIIVKLEPSGRIYIIFVIDYEFKALPFTGKVVAIDVGIEKLVTTSDGQYFPNLKPFERALTKVRELHRSLSRKRFLSHNWFKAKVKLARAYEHYYFQ	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	110 (106)
Sequences:	2508 (1444)
Seq/√Len:	140.3

ECOLI - INSQ
HALSA - Q9HSW7
SULSO - Q97XN3 Q7LX75 Q7LXH9 Q97V53 Q97XA4 Q97XQ8 Q97V47 Q97YI2 Q97Y44 Q97YW4 Q97XP1 Q97YF7 Q97V25 Q97U09 Q7LX59 Q7LXH2

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
79_L	96_A	2.836	1.00
94_F	97_K	2.714	1.00
15_I	27_I	2.593	1.00
79_L	103_A	2.515	1.00
57_T	61_Q	2.457	1.00
22_S	105_E	2.405	1.00
82_S	86_K	2.255	1.00
91_H	94_F	2.136	1.00
24_R	105_E	2.062	1.00
20_E	105_E	2.047	1.00
56_T	62_Y	2.007	1.00
72_A	107_Y	2.001	1.00
53_K	56_T	1.945	1.00
83_L	96_A	1.768	1.00
96_A	100_L	1.752	1.00
89_L	93_W	1.748	1.00
53_K	62_Y	1.713	1.00
47_I	55_V	1.673	1.00
45_V	58_S	1.661	1.00
80_H	100_L	1.657	1.00
83_L	97_K	1.633	1.00
86_K	96_A	1.573	1.00
18_K	28_I	1.551	1.00
97_K	101_A	1.512	1.00
76_V	100_L	1.478	1.00
83_L	100_L	1.435	1.00
38_L	41_T	1.383	1.00
3_V	6_D	1.377	1.00
75_K	79_L	1.347	1.00
20_E	24_R	1.334	1.00
105_E	109_F	1.330	1.00
86_K	92_N	1.323	1.00
26_Y	105_E	1.305	1.00
84_S	100_L	1.297	1.00
55_V	63_F	1.295	1.00
16_I	28_I	1.280	1.00
72_A	106_H	1.277	1.00
70_E	73_L	1.273	1.00
13_K	32_D	1.258	1.00
19_L	25_I	1.223	1.00
80_H	104_Y	1.197	1.00
4_H	13_K	1.162	0.99
69_F	72_A	1.162	0.99
93_W	96_A	1.160	0.99
65_N	68_P	1.154	0.99
14_R	30_V	1.151	0.99
92_N	99_K	1.141	0.99
92_N	95_K	1.131	0.99
86_K	90_S	1.130	0.99
69_F	73_L	1.128	0.99
43_K	59_D	1.053	0.99
79_L	82_S	1.052	0.99
103_A	107_Y	1.052	0.99
7_F	31_I	1.050	0.99
93_W	97_K	1.044	0.99
20_E	26_Y	1.033	0.99
100_L	103_A	1.024	0.99
3_V	7_F	1.022	0.99
72_A	103_A	1.019	0.99
53_K	64_P	1.010	0.99
76_V	107_Y	0.998	0.98
79_L	100_L	0.990	0.98
47_I	57_T	0.986	0.98
18_K	25_I	0.966	0.98
77_R	80_H	0.966	0.98
79_L	99_K	0.965	0.98
82_S	85_R	0.956	0.98
24_R	109_F	0.925	0.97
12_V	15_I	0.924	0.97
68_P	72_A	0.920	0.97
82_S	96_A	0.916	0.97
98_V	102_R	0.914	0.97
77_R	84_S	0.913	0.97
78_E	82_S	0.912	0.97
76_V	84_S	0.886	0.97
76_V	104_Y	0.867	0.96
3_V	12_V	0.845	0.96
75_K	103_A	0.826	0.95
57_T	63_F	0.820	0.95
77_R	81_R	0.816	0.95
83_L	93_W	0.814	0.95
75_K	78_E	0.808	0.94
49_V	65_N	0.799	0.94
18_K	30_V	0.798	0.94
84_S	97_K	0.789	0.94
104_Y	108_Y	0.767	0.93
7_F	12_V	0.765	0.93
52_E	56_T	0.762	0.92
74_T	78_E	0.761	0.92
52_E	62_Y	0.755	0.92
87_R	93_W	0.754	0.92
10_D	55_V	0.720	0.90
45_V	57_T	0.709	0.89
77_R	82_S	0.706	0.89
12_V	30_V	0.705	0.89
8_P	31_I	0.697	0.89
84_S	96_A	0.694	0.88
22_S	26_Y	0.694	0.88
22_S	101_A	0.693	0.88
87_R	90_S	0.692	0.88
51_I	67_K	0.685	0.88
51_I	54_L	0.682	0.88
40_F	43_K	0.679	0.87
51_I	65_N	0.664	0.86
54_L	63_F	0.663	0.86
23_G	105_E	0.663	0.86
37_A	40_F	0.659	0.86
54_L	65_N	0.654	0.85
77_R	100_L	0.653	0.85
73_L	77_R	0.649	0.85
90_S	93_W	0.648	0.85
25_I	30_V	0.646	0.85
45_V	59_D	0.644	0.84
86_K	93_W	0.643	0.84
80_H	83_L	0.639	0.84
86_K	99_K	0.634	0.84
32_D	74_T	0.630	0.83
25_I	56_T	0.625	0.83
63_F	68_P	0.623	0.82
14_R	28_I	0.622	0.82
99_K	103_A	0.617	0.82
83_L	86_K	0.614	0.82
33_Y	36_K	0.599	0.80
20_E	109_F	0.596	0.80
47_I	54_L	0.593	0.79
49_V	73_L	0.585	0.78
25_I	49_V	0.584	0.78
91_H	98_V	0.580	0.78
82_S	99_K	0.580	0.78
103_A	106_H	0.579	0.78
50_G	63_F	0.579	0.78
8_P	11_K	0.578	0.78
3_V	54_L	0.577	0.77
50_G	53_K	0.572	0.77
67_K	70_E	0.566	0.76
20_E	108_Y	0.566	0.76
81_R	96_A	0.564	0.76
10_D	13_K	0.561	0.75
49_V	54_L	0.561	0.75
4_H	23_G	0.560	0.75
81_R	85_R	0.542	0.73
36_K	91_H	0.541	0.73
3_V	29_F	0.537	0.72
79_L	83_L	0.534	0.72
80_H	89_L	0.531	0.71
15_I	28_I	0.528	0.71
38_L	44_V	0.525	0.71
10_D	50_G	0.522	0.70
3_V	13_K	0.522	0.70
73_L	80_H	0.520	0.70
22_S	109_F	0.519	0.70
12_V	31_I	0.518	0.70
95_K	98_V	0.516	0.69
10_D	29_F	0.513	0.69
69_F	107_Y	0.513	0.69
73_L	78_E	0.507	0.68
4_H	12_V	0.502	0.67
50_G	55_V	0.501	0.67
5_R	10_D	0.500	0.67

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1neiA	2	0.4091	84.8	0.881	Contact Map
4ncpA	5	0.9	61.6	0.902	Contact Map
4ogeA	1	0.5273	59.9	0.903	Contact Map
1y7uA	5	0.9364	37.3	0.915	Contact Map
1vpmA	5	0.8091	30.6	0.919	Contact Map
4zv3A	3	0.7818	28.9	0.92	Contact Map
2qq2A	5	0.8364	21.3	0.925	Contact Map
2v1oA	5	0.8182	20.9	0.925	Contact Map
3zyyX	2	0.9	20.8	0.925	Contact Map
2pzhA	4	0.6636	19	0.926	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.006 seconds.