Q97XN2 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97XN2 - Partial transposase in ISC1316

UniProt:	Q97XN2	Sequences: MKNLRRDIYMKLGKYFAEHYDTVVMEDINVKKLVGKSLKVMRRRLHDIGFYEFRTILEYQLIKYGKKFTLVDPAYTSMTCARCGYVREDLTGVFSCSHLIRYHIVKLYQVLSNILYSLQVSLI	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	123 (114)
Sequences:	3504 (1996)
Seq/√Len:	186.9

ECOLI - INSQ
HALSA - Q9HSD4 Q9HSW9 Q9HHU6 Q9HSW7 Q9HSY4 Q9HM87 Q9HHJ9 Q9HHG8 Q9HSZ6 Q9HHX8
SULSO - Q97XN2 Q97YH4 Q97XA4 Q97V53 Q97XB6 Q97Y44 Q97XQ8 Q97YF7 Q97YI2 Q97XP1 Q97YI5 Q97V47 Q97XQ0 Q97YW4 Q97U09 Q97V25 Q97YU1 Q7LX59 Q97Y48 Q97Z61 Q97U51 Q97YK6 Q97YW9 Q97U68 Q97UQ8 Q97X39 Q97WZ3 Q97Y67 Q97WY6 Q7LXH6 Q7LXD9 Q7LXH2 Q7LX74 Y2105 Q97Y27

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
7_D	11_K	3.432	1.00
29_N	32_K	3.028	1.00
81_A	109_Q	2.796	1.00
54_R	70_L	2.770	1.00
61_L	68_F	2.536	1.00
24_V	118_L	2.513	1.00
34_V	46_H	2.327	1.00
52_E	56_I	2.277	1.00
25_M	57_L	2.172	1.00
14_K	18_E	2.051	1.00
71_V	114_I	1.975	1.00
21_D	66_K	1.787	1.00
79_T	86_V	1.786	1.00
75_Y	78_M	1.730	1.00
95_S	103_H	1.679	1.00
9_Y	52_E	1.639	1.00
39_K	42_R	1.635	1.00
52_E	55_T	1.633	1.00
58_E	70_L	1.611	1.00
76_T	114_I	1.598	1.00
9_Y	56_I	1.589	1.00
78_M	90_L	1.546	1.00
17_A	61_L	1.546	1.00
25_M	68_F	1.539	1.00
87_R	90_L	1.532	1.00
82_R	102_Y	1.469	1.00
10_M	59_Y	1.458	1.00
92_G	106_K	1.457	1.00
13_G	56_I	1.449	1.00
10_M	56_I	1.435	1.00
45_L	50_F	1.433	1.00
87_R	91_T	1.412	1.00
94_F	104_I	1.397	1.00
6_R	52_E	1.389	1.00
78_M	88_E	1.377	1.00
53_F	57_L	1.361	1.00
25_M	70_L	1.318	1.00
17_A	66_K	1.315	1.00
26_E	73_P	1.299	1.00
94_F	102_Y	1.274	1.00
25_M	54_R	1.241	1.00
27_D	70_L	1.231	1.00
10_M	60_Q	1.197	1.00
112_S	116_Y	1.192	1.00
15_Y	19_H	1.184	1.00
29_N	73_P	1.172	1.00
85_Y	97_S	1.172	1.00
9_Y	53_F	1.168	1.00
23_V	61_L	1.144	1.00
71_V	117_S	1.134	1.00
6_R	56_I	1.132	1.00
36_K	42_R	1.131	1.00
17_A	64_Y	1.126	1.00
87_R	94_F	1.092	1.00
10_M	13_G	1.091	1.00
61_L	66_K	1.057	1.00
93_V	103_H	1.057	1.00
81_A	104_I	1.049	1.00
108_Y	112_S	1.026	1.00
8_I	12_L	1.015	1.00
87_R	97_S	1.013	1.00
85_Y	98_H	1.011	1.00
14_K	64_Y	1.009	1.00
104_I	108_Y	1.003	0.99
36_K	39_K	0.998	0.99
58_E	62_I	0.998	0.99
36_K	40_V	0.986	0.99
2_K	6_R	0.962	0.99
30_V	51_Y	0.959	0.99
13_G	53_F	0.934	0.99
56_I	59_Y	0.929	0.99
27_D	73_P	0.926	0.99
24_V	114_I	0.915	0.99
76_T	117_S	0.908	0.99
104_I	112_S	0.902	0.99
13_G	59_Y	0.889	0.99
88_E	91_T	0.875	0.99
92_G	105_V	0.870	0.99
108_Y	111_L	0.867	0.98
58_E	68_F	0.857	0.98
9_Y	13_G	0.847	0.98
12_L	53_F	0.845	0.98
24_V	69_T	0.845	0.98
18_E	22_T	0.839	0.98
69_T	118_L	0.837	0.98
73_P	76_T	0.833	0.98
12_L	15_Y	0.825	0.98
81_A	112_S	0.817	0.98
79_T	117_S	0.806	0.98
9_Y	49_G	0.806	0.98
51_Y	55_T	0.803	0.97
30_V	50_F	0.794	0.97
91_T	106_K	0.790	0.97
60_Q	63_K	0.782	0.97
81_A	116_Y	0.781	0.97
6_R	10_M	0.771	0.97
75_Y	117_S	0.769	0.97
5_R	47_D	0.767	0.97
55_T	58_E	0.765	0.97
41_M	44_R	0.764	0.97
33_L	45_L	0.757	0.96
81_A	102_Y	0.738	0.96
82_R	112_S	0.737	0.96
17_A	23_V	0.722	0.95
13_G	60_Q	0.721	0.95
16_F	23_V	0.719	0.95
13_G	57_L	0.718	0.95
88_E	94_F	0.698	0.94
27_D	54_R	0.683	0.94
34_V	42_R	0.675	0.93
22_T	69_T	0.673	0.93
112_S	115_L	0.660	0.93
59_Y	63_K	0.659	0.93
109_Q	113_N	0.656	0.92
90_L	106_K	0.650	0.92
79_T	116_Y	0.646	0.92
22_T	67_K	0.645	0.92
93_V	104_I	0.645	0.92
71_V	118_L	0.643	0.92
24_V	115_L	0.640	0.91
78_M	86_V	0.633	0.91
84_G	113_N	0.619	0.90
14_K	17_A	0.619	0.90
72_D	75_Y	0.608	0.89
110_V	113_N	0.603	0.89
36_K	41_M	0.603	0.89
18_E	64_Y	0.602	0.89
8_I	53_F	0.599	0.89
86_V	90_L	0.598	0.88
58_E	67_K	0.596	0.88
17_A	20_Y	0.596	0.88
76_T	113_N	0.591	0.88
28_I	73_P	0.574	0.86
36_K	44_R	0.572	0.86
4_L	8_I	0.572	0.86
79_T	84_G	0.569	0.86
41_M	45_L	0.566	0.86
48_I	51_Y	0.564	0.85
85_Y	89_D	0.561	0.85
85_Y	94_F	0.561	0.85
22_T	118_L	0.560	0.85
3_N	6_R	0.556	0.85
54_R	58_E	0.554	0.84
42_R	46_H	0.551	0.84
40_V	44_R	0.551	0.84
95_S	102_Y	0.549	0.84
82_R	104_I	0.548	0.84
95_S	104_I	0.548	0.84
32_K	73_P	0.548	0.84
24_V	117_S	0.540	0.83
20_Y	66_K	0.540	0.83
20_Y	115_L	0.536	0.82
32_K	45_L	0.528	0.81
91_T	94_F	0.528	0.81
77_S	90_L	0.526	0.81
36_K	46_H	0.524	0.81
16_F	108_Y	0.524	0.81
15_Y	23_V	0.523	0.81
3_N	7_D	0.523	0.81
32_K	36_K	0.522	0.81
44_R	48_I	0.522	0.81
72_D	117_S	0.521	0.81
10_M	14_K	0.519	0.80
102_Y	112_S	0.518	0.80
30_V	45_L	0.517	0.80
17_A	68_F	0.513	0.80
39_K	46_H	0.513	0.80
54_R	68_F	0.511	0.79
34_V	39_K	0.508	0.79
81_A	110_V	0.506	0.79
14_K	60_Q	0.500	0.78

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1yuzA	2	0.8455	86.7	0.887	Contact Map
2k4xA	1	0.4309	86.7	0.887	Contact Map
1qypA	1	0.3496	86.1	0.888	Contact Map
3j20Y	1	0.3902	81.2	0.894	Contact Map
4d02A	2	0.3984	80.5	0.895	Contact Map
6rxnA	1	0.2846	78.8	0.897	Contact Map
4aybP	1	0.3252	77.4	0.898	Contact Map
2m4yA	1	0.3089	74.2	0.901	Contact Map
4c2mI	1	0.4146	74.2	0.901	Contact Map
1h7bA	2	0.5935	72.7	0.902	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0069 seconds.