Q97XJ3 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97XJ3 - Terminal quinol oxidase, subunit (DoxD)

UniProt:	Q97XJ3	Sequences: MGKMANKQVVDNLTRKEYLFPIRFAVGWMFFDGGIRKAILKPAKLDPNSSSFVGGKLVNFLPHAGPFKDFLLMTLENRTFDVTFLTIFSYVEILVGLFLIIGFLTRLSAFGAAVMAIGMAPAYWLGSTCEDEWQIGSLLTAGAIVLMLTAAGRVWGVDYYLYKKFGDWSLSKKIPLLNLIKFW	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	183 (159)
Sequences:	100 (60)
Seq/√Len:	4.8

SULSO - Q97XJ3 Q97X72

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
83_T	100_I	3.090	0.71
110_F	147_M	3.053	0.70
99_L	146_L	2.727	0.61
22_I	142_G	2.573	0.56
25_A	28_W	2.417	0.51
21_P	39_I	2.360	0.49
30_F	66_P	2.272	0.46
94_L	114_V	2.168	0.43
26_V	82_V	2.111	0.41
15_R	21_P	2.070	0.40
103_F	161_L	2.064	0.40
19_L	149_T	2.053	0.40
70_F	91_V	2.032	0.39
101_I	164_K	1.997	0.38
49_S	160_Y	1.960	0.37
30_F	116_A	1.948	0.36
104_L	148_L	1.927	0.36
99_L	142_G	1.926	0.36
159_Y	163_K	1.861	0.34
68_K	161_L	1.807	0.32
38_A	43_A	1.756	0.31
53_V	82_V	1.698	0.29
13_L	161_L	1.698	0.29
160_Y	169_S	1.696	0.29
98_F	148_L	1.692	0.29
26_V	100_I	1.637	0.28
50_S	98_F	1.619	0.27
75_L	110_F	1.596	0.27
43_A	48_N	1.593	0.27
80_F	151_A	1.585	0.27
54_G	60_F	1.481	0.24
41_K	48_N	1.481	0.24
80_F	117_I	1.467	0.24
32_D	60_F	1.466	0.24
71_L	121_P	1.457	0.24
137_S	141_A	1.452	0.23
20_F	146_L	1.436	0.23
91_V	107_L	1.425	0.23
157_V	163_K	1.422	0.23
72_L	76_E	1.380	0.22
66_P	100_I	1.356	0.21
146_L	151_A	1.345	0.21
37_K	123_Y	1.342	0.21
100_I	160_Y	1.340	0.21
91_V	140_T	1.318	0.21
33_G	89_S	1.298	0.20
114_V	153_R	1.296	0.20
60_F	134_Q	1.293	0.20
60_F	135_I	1.293	0.20
139_L	143_A	1.292	0.20
91_V	155_W	1.284	0.20
104_L	169_S	1.277	0.20
70_F	94_L	1.267	0.19
34_G	52_F	1.258	0.19
117_I	125_L	1.258	0.19
49_S	99_L	1.213	0.18
120_A	136_G	1.211	0.18
18_Y	149_T	1.208	0.18
86_T	140_T	1.206	0.18
108_S	127_S	1.206	0.18
104_L	147_M	1.199	0.18
30_F	147_M	1.188	0.18
80_F	86_T	1.147	0.17
114_V	144_I	1.141	0.17
35_I	63_H	1.134	0.17
74_T	115_M	1.134	0.17
73_M	104_L	1.130	0.17
81_D	128_T	1.117	0.17
161_L	166_G	1.090	0.16
33_G	120_A	1.083	0.16
13_L	77_N	1.082	0.16
77_N	94_L	1.077	0.16
57_L	143_A	1.077	0.16
103_F	165_F	1.054	0.16
104_L	111_G	1.051	0.16
71_L	112_A	1.042	0.15
25_A	74_T	1.036	0.15
52_F	109_A	1.034	0.15
128_T	133_W	1.034	0.15
163_K	166_G	1.030	0.15
39_I	164_K	1.024	0.15
87_I	149_T	1.021	0.15
33_G	119_M	1.016	0.15
66_P	143_A	1.012	0.15
43_A	103_F	1.000	0.15
39_I	101_I	0.983	0.14
25_A	115_M	0.976	0.14
104_L	137_S	0.976	0.14
87_I	110_F	0.974	0.14
14_T	103_F	0.969	0.14
100_I	112_A	0.952	0.14
32_D	89_S	0.948	0.14
141_A	151_A	0.948	0.14
119_M	134_Q	0.940	0.14
119_M	135_I	0.940	0.14
46_D	49_S	0.940	0.14
24_F	152_G	0.935	0.14
163_K	167_D	0.931	0.14
33_G	135_I	0.930	0.14
33_G	134_Q	0.930	0.14
15_R	110_F	0.923	0.14
49_S	146_L	0.921	0.14
12_N	83_T	0.913	0.13
148_L	160_Y	0.907	0.13
85_L	155_W	0.906	0.13
51_S	59_N	0.898	0.13
82_V	100_I	0.897	0.13
58_V	143_A	0.884	0.13
125_L	142_G	0.883	0.13
146_L	163_K	0.877	0.13
20_F	155_W	0.876	0.13
145_V	149_T	0.876	0.13
161_L	165_F	0.874	0.13
81_D	123_Y	0.872	0.13
87_I	107_L	0.872	0.13
111_G	164_K	0.867	0.13
113_A	152_G	0.866	0.13
157_V	165_F	0.859	0.13
22_I	161_L	0.855	0.13
160_Y	163_K	0.851	0.13
117_I	144_I	0.843	0.12
31_F	119_M	0.841	0.12
54_G	135_I	0.839	0.12
54_G	134_Q	0.839	0.12
34_G	119_M	0.835	0.12
21_P	153_R	0.823	0.12
120_A	135_I	0.823	0.12
120_A	134_Q	0.823	0.12
27_G	105_T	0.804	0.12
157_V	160_Y	0.803	0.12
87_I	163_K	0.798	0.12
167_D	171_S	0.797	0.12
104_L	163_K	0.797	0.12
164_K	169_S	0.793	0.12
93_I	164_K	0.789	0.12
153_R	163_K	0.775	0.11
77_N	142_G	0.775	0.11
54_G	61_L	0.774	0.11
101_I	168_W	0.770	0.11
78_R	89_S	0.769	0.11
57_L	121_P	0.769	0.11
118_G	135_I	0.768	0.11
118_G	134_Q	0.768	0.11
87_I	170_L	0.766	0.11
35_I	55_G	0.761	0.11
46_D	145_V	0.760	0.11
63_H	135_I	0.751	0.11
63_H	134_Q	0.751	0.11
60_F	119_M	0.745	0.11
32_D	156_G	0.742	0.11
151_A	163_K	0.732	0.11
14_T	145_V	0.732	0.11
54_G	119_M	0.727	0.11
58_V	139_L	0.720	0.11
24_F	59_N	0.716	0.11
21_P	83_T	0.708	0.11
39_I	168_W	0.704	0.11
40_L	138_L	0.703	0.11
30_F	127_S	0.702	0.11
146_L	152_G	0.700	0.11
86_T	91_V	0.695	0.11
77_N	162_Y	0.694	0.10
15_R	167_D	0.692	0.10
141_A	144_I	0.691	0.10
157_V	172_K	0.689	0.10
101_I	107_L	0.687	0.10
29_M	53_V	0.687	0.10
73_M	80_F	0.686	0.10
119_M	137_S	0.686	0.10
33_G	58_V	0.684	0.10
38_A	53_V	0.684	0.10
33_G	121_P	0.683	0.10
101_I	111_G	0.681	0.10
86_T	157_V	0.680	0.10
49_S	87_I	0.676	0.10
49_S	98_F	0.676	0.10
20_F	25_A	0.675	0.10
100_I	159_Y	0.666	0.10
17_E	21_P	0.664	0.10
79_T	162_Y	0.660	0.10
87_I	160_Y	0.658	0.10
110_F	172_K	0.657	0.10
37_K	81_D	0.656	0.10
35_I	39_I	0.651	0.10
123_Y	150_A	0.642	0.10
58_V	120_A	0.641	0.10
51_S	55_G	0.637	0.10
28_W	91_V	0.637	0.10
25_A	71_L	0.635	0.10
72_L	107_L	0.628	0.10
14_T	167_D	0.622	0.10
19_L	49_S	0.618	0.10
32_D	93_I	0.617	0.10
41_K	77_N	0.611	0.10
31_F	135_I	0.609	0.10
31_F	134_Q	0.609	0.10
75_L	79_T	0.607	0.09
33_G	93_I	0.605	0.09
60_F	118_G	0.602	0.09
73_M	147_M	0.602	0.09
50_S	172_K	0.597	0.09
35_I	138_L	0.597	0.09
18_Y	164_K	0.594	0.09
30_F	75_L	0.592	0.09
130_E	139_L	0.589	0.09
32_D	119_M	0.588	0.09
80_F	166_G	0.585	0.09
73_M	86_T	0.584	0.09
70_F	114_V	0.584	0.09
87_I	114_V	0.580	0.09
50_S	157_V	0.579	0.09
24_F	89_S	0.578	0.09
73_M	107_L	0.571	0.09
160_Y	167_D	0.571	0.09
70_F	151_A	0.571	0.09
167_D	170_L	0.568	0.09
30_F	112_A	0.567	0.09
87_I	113_A	0.564	0.09
28_W	100_I	0.561	0.09
40_L	130_E	0.558	0.09
68_K	122_A	0.558	0.09
70_F	84_F	0.556	0.09
49_S	155_W	0.553	0.09
20_F	151_A	0.538	0.09
21_P	98_F	0.537	0.09
28_W	115_M	0.533	0.09
48_N	77_N	0.531	0.09
17_E	55_G	0.528	0.09
18_Y	46_D	0.527	0.09
13_L	70_F	0.527	0.09
29_M	116_A	0.527	0.09
90_Y	111_G	0.526	0.09
86_T	93_I	0.520	0.09
70_F	148_L	0.517	0.09
52_F	127_S	0.506	0.08
107_L	111_G	0.505	0.08
30_F	94_L	0.502	0.08
28_W	138_L	0.500	0.08

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2giyA	2	0.2951	2.8	0.976	Contact Map
3klyA	3	0.4754	2.1	0.978	Contact Map
1vyiA	1	0.2623	2.1	0.978	Contact Map
4kieA	1	0.2459	2	0.978	Contact Map
4im4A	1	0.3607	2	0.978	Contact Map
2m7gA	1	0.3333	1.9	0.978	Contact Map
4htyA	1	0.3607	1.9	0.978	Contact Map
2wcwA	2	0.3607	1.9	0.978	Contact Map
3kcuA	3	0.4426	1.9	0.978	Contact Map
3oa1A	1	0.306	1.8	0.979	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.007 seconds.