Q97XI7 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97XI7 - Second ORF in transposon ISC1078

UniProt:	Q97XI7	Sequences: MGEGTRGEAFKKIREGYKVHIFDESYVSYINKGKGWMKVGGGIKVNPKRKRFAVVGGITISKEGITFSYSTYKKPSLNSKDIILYLRKVIKDEKTVIVMDNARIHGNEVREFLEENGVEFVYLPPYSPDKSPAEGPWAVLKKRLYSKIYTDFETLMWDATRFLRSISKRVNDLTYSVKRCGEPLDVNTE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	189 (163)
Sequences:	1956 (1477)
Seq/√Len:	115.7

SULSO - Q97XI7 Q97TW3 Q97XI6 Q97TV5 Q7LX66 Q97XL9

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
79_S	109_V	3.195	1.00
75_P	107_N	2.906	1.00
24_E	141_K	2.852	1.00
78_N	99_M	2.759	1.00
57_G	64_G	2.682	1.00
56_G	137_W	2.623	1.00
74_K	77_L	2.516	1.00
79_S	108_E	2.451	1.00
98_V	123_L	2.443	1.00
21_I	97_I	2.370	1.00
111_E	115_E	2.360	1.00
27_V	51_R	2.322	1.00
112_F	116_N	2.271	1.00
87_R	116_N	2.203	1.00
99_M	113_L	1.980	1.00
162_F	165_S	1.941	1.00
138_A	142_K	1.935	1.00
68_S	156_M	1.931	1.00
75_P	79_S	1.865	1.00
152_F	156_M	1.812	1.00
25_S	51_R	1.709	1.00
96_V	121_V	1.702	1.00
80_K	84_L	1.696	1.00
143_R	162_F	1.671	1.00
26_Y	159_A	1.656	1.00
58_I	170_V	1.652	1.00
79_S	107_N	1.623	1.00
140_L	162_F	1.612	1.00
14_R	17_Y	1.584	1.00
79_S	112_F	1.571	1.00
27_V	49_R	1.548	1.00
58_I	136_P	1.531	1.00
103_R	106_G	1.514	1.00
26_Y	54_V	1.496	1.00
139_V	143_R	1.475	1.00
146_S	149_Y	1.465	1.00
56_G	133_A	1.463	1.00
25_S	30_I	1.431	1.00
156_M	160_T	1.417	1.00
113_L	120_F	1.402	1.00
106_G	110_R	1.386	1.00
26_Y	144_L	1.383	1.00
85_Y	88_K	1.379	1.00
21_I	78_N	1.359	1.00
168_K	171_N	1.350	1.00
73_K	103_R	1.350	1.00
154_T	157_W	1.330	1.00
157_W	161_R	1.322	1.00
75_P	108_E	1.307	1.00
59_T	62_K	1.306	1.00
45_V	48_K	1.295	1.00
135_G	138_A	1.287	0.99
20_H	58_I	1.271	0.99
140_L	166_I	1.265	0.99
99_M	122_Y	1.259	0.99
161_R	165_S	1.253	0.99
94_K	119_E	1.244	0.99
99_M	120_F	1.233	0.99
150_T	154_T	1.227	0.99
79_S	83_I	1.224	0.99
21_I	55_V	1.207	0.99
149_Y	154_T	1.205	0.99
135_G	176_S	1.197	0.99
131_S	134_E	1.193	0.99
173_L	176_S	1.192	0.99
172_D	175_Y	1.157	0.99
160_T	164_R	1.138	0.99
108_E	111_E	1.129	0.99
54_V	159_A	1.127	0.99
151_D	154_T	1.119	0.99
26_Y	141_K	1.118	0.99
75_P	109_V	1.097	0.98
161_R	164_R	1.090	0.98
24_E	29_Y	1.083	0.98
74_K	104_I	1.082	0.98
35_G	41_G	1.076	0.98
83_I	112_F	1.071	0.98
83_I	115_E	1.068	0.98
106_G	122_Y	1.066	0.98
171_N	175_Y	1.061	0.98
78_N	129_D	1.049	0.98
170_V	173_L	1.048	0.98
22_F	102_A	1.046	0.98
25_S	53_A	1.036	0.98
25_S	104_I	1.024	0.97
38_K	41_G	1.019	0.97
107_N	110_R	1.015	0.97
27_V	31_N	1.001	0.97
24_E	159_A	0.999	0.97
101_N	106_G	0.998	0.97
98_V	131_S	0.996	0.97
17_Y	94_K	0.980	0.97
162_F	166_I	0.963	0.96
73_K	77_L	0.958	0.96
82_I	112_F	0.958	0.96
100_D	105_H	0.949	0.96
60_I	174_T	0.948	0.96
147_K	158_D	0.947	0.96
132_P	174_T	0.945	0.96
78_N	81_D	0.941	0.96
73_K	104_I	0.937	0.96
37_M	42_G	0.936	0.96
76_S	80_K	0.903	0.95
76_S	108_E	0.902	0.95
69_Y	77_L	0.900	0.95
78_N	82_I	0.897	0.95
105_H	141_K	0.892	0.94
153_E	169_R	0.883	0.94
65_I	89_V	0.883	0.94
52_F	68_S	0.881	0.94
48_K	51_R	0.878	0.94
169_R	172_D	0.874	0.94
21_I	99_M	0.873	0.94
167_S	171_N	0.871	0.94
23_D	105_H	0.870	0.94
170_V	174_T	0.867	0.93
20_H	98_V	0.857	0.93
143_R	165_S	0.851	0.93
134_E	173_L	0.849	0.93
111_E	114_E	0.845	0.93
37_M	41_G	0.844	0.93
110_R	122_Y	0.843	0.93
152_F	155_L	0.839	0.92
113_L	118_V	0.831	0.92
110_R	114_E	0.830	0.92
78_N	97_I	0.828	0.92
17_Y	96_V	0.826	0.92
32_K	36_W	0.824	0.92
158_D	162_F	0.822	0.92
153_E	165_S	0.821	0.91
156_M	161_R	0.818	0.91
15_E	18_K	0.818	0.91
86_L	97_I	0.813	0.91
149_Y	158_D	0.806	0.91
90_I	95_T	0.799	0.90
53_A	102_A	0.779	0.89
56_G	136_P	0.773	0.89
35_G	42_G	0.772	0.89
99_M	123_L	0.770	0.89
61_S	67_F	0.769	0.89
163_L	166_I	0.764	0.88
62_K	170_V	0.763	0.88
28_S	155_L	0.762	0.88
153_E	158_D	0.756	0.88
16_G	175_Y	0.750	0.87
56_G	66_T	0.747	0.87
91_K	116_N	0.736	0.86
135_G	173_L	0.731	0.86
64_G	89_V	0.728	0.86
16_G	60_I	0.722	0.85
158_D	161_R	0.717	0.85
26_Y	140_L	0.715	0.85
71_T	77_L	0.713	0.85
31_N	148_I	0.712	0.84
74_K	79_S	0.709	0.84
138_A	141_K	0.708	0.84
20_H	25_S	0.705	0.84
168_K	175_Y	0.704	0.84
56_G	134_E	0.704	0.84
101_N	125_P	0.696	0.83
58_I	132_P	0.694	0.83
101_N	134_E	0.677	0.81
38_K	116_N	0.676	0.81
44_K	157_W	0.674	0.81
70_S	156_M	0.670	0.81
136_P	173_L	0.665	0.80
61_S	171_N	0.665	0.80
73_K	102_A	0.656	0.79
24_E	54_V	0.655	0.79
20_H	137_W	0.653	0.79
123_L	131_S	0.649	0.79
21_I	57_G	0.643	0.78
35_G	38_K	0.639	0.78
21_I	123_L	0.639	0.78
26_Y	162_F	0.636	0.77
155_L	159_A	0.631	0.77
50_K	53_A	0.630	0.77
141_K	145_Y	0.630	0.77
40_G	128_P	0.627	0.76
99_M	102_A	0.620	0.75
54_V	66_T	0.619	0.75
85_Y	89_V	0.618	0.75
51_R	73_K	0.616	0.75
37_M	69_Y	0.614	0.75
137_W	170_V	0.613	0.75
32_K	142_K	0.610	0.74
112_F	115_E	0.608	0.74
45_V	50_K	0.606	0.74
83_I	87_R	0.606	0.74
90_I	97_I	0.601	0.73
157_W	164_R	0.593	0.72
150_T	158_D	0.592	0.72
55_V	99_M	0.588	0.72
125_P	169_R	0.587	0.71
156_M	159_A	0.587	0.71
161_R	169_R	0.587	0.71
55_V	123_L	0.584	0.71
63_E	136_P	0.584	0.71
140_L	156_M	0.582	0.71
75_P	104_I	0.578	0.70
169_R	175_Y	0.578	0.70
125_P	156_M	0.576	0.70
24_E	137_W	0.574	0.70
58_I	63_E	0.569	0.69
112_F	119_E	0.565	0.69
75_P	103_R	0.564	0.68
134_E	137_W	0.562	0.68
65_I	84_L	0.560	0.68
109_V	112_F	0.559	0.68
99_M	125_P	0.557	0.67
126_Y	141_K	0.557	0.67
81_D	85_Y	0.556	0.67
73_K	81_D	0.555	0.67
99_M	109_V	0.554	0.67
44_K	47_P	0.553	0.67
67_F	80_K	0.552	0.67
91_K	175_Y	0.549	0.66
45_V	59_T	0.547	0.66
108_E	122_Y	0.545	0.66
164_R	175_Y	0.543	0.66
133_A	137_W	0.539	0.65
154_T	165_S	0.539	0.65
65_I	118_V	0.539	0.65
94_K	118_V	0.534	0.64
63_E	137_W	0.533	0.64
29_Y	36_W	0.533	0.64
73_K	112_F	0.531	0.64
115_E	153_E	0.529	0.64
93_E	151_D	0.527	0.63
84_L	112_F	0.525	0.63
28_S	49_R	0.524	0.63
47_P	73_K	0.520	0.62
28_S	125_P	0.515	0.61
48_K	104_I	0.514	0.61
87_R	112_F	0.508	0.60
52_F	140_L	0.508	0.60
53_A	72_Y	0.507	0.60
98_V	134_E	0.507	0.60
109_V	122_Y	0.504	0.60
113_L	116_N	0.504	0.60
23_D	26_Y	0.501	0.59
62_K	85_Y	0.501	0.59
131_S	136_P	0.501	0.59
14_R	18_K	0.500	0.59

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3f2kA	1	0.8942	100	0.273	Contact Map
4mdaA	1	0.8942	100	0.295	Contact Map
4u7bA	2	1	100	0.44	Contact Map
4fcyA	4	0.9101	98.8	0.783	Contact Map
1c6vA	4	0.746	97.4	0.847	Contact Map
4fw1A	2	0.8413	97.3	0.85	Contact Map
4mq3A	1	0.672	97.1	0.854	Contact Map
3l3uA	2	0.7831	97.1	0.854	Contact Map
1cxqA	2	0.7354	96.6	0.864	Contact Map
2x78A	2	0.8042	96.6	0.864	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.007 seconds.