Q97XI6 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97XI6 - Second ORF in transposon ISC1395

UniProt:	Q97XI6	Sequences: MFFTDESGIHHDPSKVRRLGLYNVPVDYPSRKLNVLASIPLFDGVPCFMFTYSNVNSEIFAEFLRLFRNSGPIVLILDNAKFHKNAYVFSVASQLGITLLFLPPYSPDLNPIELVWKDLKRWVNTYYNLEYTLDSMEEEFYYLFLRECSQTVMKFKKRL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	159 (146)
Sequences:	2020 (1481)
Seq/√Len:	122.5

SULSO - Q97XI6 Q97TW3 Q97XI7 Q97TV5 Q7LX66 Q97XL9

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
61_A	87_Y	3.791	1.00
57_S	85_N	3.448	1.00
56_N	59_I	3.219	1.00
61_A	88_V	2.917	1.00
60_F	77_L	2.583	1.00
38_S	46_P	2.568	1.00
4_T	75_L	2.427	1.00
90_S	94_Q	2.419	1.00
10_H	32_K	2.412	1.00
77_L	92_A	2.390	1.00
117_K	121_R	2.181	1.00
37_A	116_W	2.150	1.00
76_I	102_L	2.107	1.00
7_S	120_K	2.097	1.00
143_L	146_R	2.090	1.00
50_F	137_E	2.054	1.00
91_V	95_L	1.988	1.00
118_D	122_W	1.930	1.00
74_V	100_L	1.906	1.00
20_G	26_V	1.898	1.00
138_E	142_Y	1.769	1.00
9_I	35_V	1.767	1.00
86_A	90_S	1.729	1.00
119_L	143_L	1.622	1.00
130_E	135_S	1.617	1.00
61_A	85_N	1.604	1.00
9_I	140_F	1.584	1.00
40_P	43_D	1.560	1.00
21_L	24_V	1.537	1.00
68_R	71_G	1.531	1.00
23_N	26_V	1.505	1.00
55_V	82_F	1.469	1.00
137_E	141_Y	1.449	1.00
142_Y	146_R	1.444	1.00
135_S	138_E	1.443	1.00
8_G	13_P	1.430	1.00
143_L	147_E	1.419	1.00
37_A	112_I	1.413	1.00
64_L	91_V	1.382	1.00
133_L	137_E	1.375	1.00
119_L	147_E	1.371	1.00
52_Y	137_E	1.367	1.00
55_V	59_I	1.341	1.00
81_K	84_K	1.341	1.00
57_S	61_A	1.323	1.00
85_N	88_V	1.307	1.00
65_R	91_V	1.303	1.00
77_L	99_L	1.270	1.00
139_E	143_L	1.260	1.00
79_N	84_K	1.248	0.99
84_K	89_F	1.239	0.99
141_Y	145_L	1.236	0.99
77_L	101_F	1.232	0.99
8_G	32_K	1.232	0.99
40_P	73_I	1.197	0.99
134_D	146_R	1.196	0.99
4_T	60_F	1.183	0.99
7_S	35_V	1.172	0.99
92_A	97_I	1.156	0.99
57_S	88_V	1.147	0.99
61_A	91_V	1.119	0.99
79_N	104_P	1.101	0.99
10_H	14_S	1.096	0.99
40_P	44_G	1.085	0.99
92_A	99_L	1.085	0.99
8_G	82_F	1.085	0.99
130_E	139_E	1.084	0.99
20_G	23_N	1.074	0.98
58_E	87_Y	1.071	0.98
15_K	19_L	1.059	0.98
39_I	115_V	1.041	0.98
61_A	65_R	1.040	0.98
114_L	117_K	1.040	0.98
15_K	21_L	1.021	0.98
84_K	101_F	1.018	0.98
18_R	23_N	1.018	0.98
10_H	30_S	1.013	0.98
48_F	51_T	1.002	0.98
34_N	80_A	0.996	0.97
102_L	110_N	0.994	0.97
76_I	105_Y	0.993	0.97
70_S	73_I	0.978	0.97
57_S	87_Y	0.968	0.97
3_F	42_F	0.960	0.97
4_T	36_L	0.958	0.97
9_I	123_V	0.955	0.97
71_G	94_Q	0.952	0.97
132_T	135_S	0.946	0.97
51_T	55_V	0.932	0.96
122_W	143_L	0.925	0.96
110_N	113_E	0.923	0.96
90_S	93_S	0.915	0.96
17_R	23_N	0.909	0.96
64_L	92_A	0.908	0.96
16_V	19_L	0.906	0.96
55_V	81_K	0.888	0.95
77_L	102_L	0.887	0.95
123_V	126_Y	0.887	0.95
89_F	93_S	0.886	0.95
38_S	66_L	0.882	0.95
73_I	97_I	0.873	0.95
80_A	116_W	0.871	0.95
124_N	131_Y	0.862	0.94
137_E	140_F	0.861	0.94
142_Y	149_S	0.844	0.94
131_Y	135_S	0.842	0.93
6_E	83_H	0.836	0.93
4_T	77_L	0.833	0.93
120_K	124_N	0.833	0.93
22_Y	71_G	0.807	0.92
115_V	147_E	0.804	0.92
75_L	92_A	0.799	0.92
8_G	12_D	0.783	0.91
123_V	130_E	0.770	0.90
29_P	33_L	0.754	0.89
134_D	150_Q	0.751	0.89
126_Y	143_L	0.743	0.88
132_T	145_L	0.743	0.88
3_F	76_I	0.741	0.88
37_A	48_F	0.727	0.87
15_K	20_G	0.723	0.87
85_N	89_F	0.723	0.87
126_Y	139_E	0.720	0.87
3_F	8_G	0.710	0.86
121_R	125_T	0.706	0.86
117_K	120_K	0.704	0.86
133_L	136_M	0.703	0.85
68_R	146_R	0.687	0.84
54_N	131_Y	0.687	0.84
18_R	21_L	0.686	0.84
34_N	54_N	0.680	0.84
134_D	139_E	0.677	0.83
89_F	99_L	0.673	0.83
137_E	142_Y	0.672	0.83
3_F	39_I	0.667	0.82
104_P	137_E	0.667	0.82
55_V	80_A	0.659	0.82
105_Y	120_K	0.657	0.81
80_A	130_E	0.657	0.81
51_T	59_I	0.655	0.81
91_V	98_T	0.650	0.81
117_K	136_M	0.650	0.81
30_S	34_N	0.646	0.80
8_G	15_K	0.641	0.80
56_N	82_F	0.636	0.79
62_E	65_R	0.634	0.79
87_Y	90_S	0.634	0.79
18_R	26_V	0.632	0.79
20_G	24_V	0.629	0.79
9_I	120_K	0.627	0.78
77_L	88_V	0.625	0.78
63_F	66_L	0.625	0.78
60_F	84_K	0.624	0.78
49_M	59_I	0.622	0.78
27_D	30_S	0.622	0.78
59_I	82_F	0.621	0.78
142_Y	145_L	0.621	0.78
124_N	127_Y	0.620	0.78
146_R	150_Q	0.619	0.77
20_G	25_P	0.617	0.77
82_F	92_A	0.617	0.77
145_L	149_S	0.615	0.77
11_H	30_S	0.612	0.77
92_A	95_L	0.610	0.76
112_I	144_F	0.609	0.76
138_E	145_L	0.609	0.76
125_T	130_E	0.609	0.76
126_Y	130_E	0.608	0.76
146_R	149_S	0.602	0.75
9_I	119_L	0.599	0.75
78_D	83_H	0.597	0.75
39_I	45_V	0.596	0.75
122_W	125_T	0.588	0.74
36_L	83_H	0.585	0.73
72_P	95_L	0.581	0.73
2_F	38_S	0.581	0.73
15_K	121_R	0.581	0.73
46_P	69_N	0.581	0.73
39_I	63_F	0.576	0.72
11_H	33_L	0.575	0.72
39_I	46_P	0.573	0.72
97_I	124_N	0.570	0.71
94_Q	134_D	0.570	0.71
101_F	106_S	0.565	0.71
124_N	140_F	0.562	0.70
16_V	21_L	0.561	0.70
43_D	47_C	0.558	0.70
47_C	97_I	0.548	0.69
136_M	140_F	0.542	0.68
134_D	141_Y	0.542	0.68
57_S	86_A	0.541	0.68
3_F	25_P	0.541	0.68
6_E	9_I	0.540	0.67
49_M	62_E	0.539	0.67
31_R	133_L	0.538	0.67
89_F	97_I	0.536	0.67
65_R	68_R	0.535	0.67
91_V	94_Q	0.534	0.67
136_M	139_E	0.532	0.66
40_P	46_P	0.530	0.66
15_K	18_R	0.530	0.66
79_N	82_F	0.529	0.66
22_Y	25_P	0.529	0.66
5_D	107_P	0.524	0.65
134_D	138_E	0.523	0.65
126_Y	142_Y	0.518	0.64
135_S	146_R	0.518	0.64
102_L	105_Y	0.517	0.64
10_H	29_P	0.516	0.64
123_V	143_L	0.514	0.64
119_L	145_L	0.512	0.63
127_Y	131_Y	0.511	0.63
31_R	34_N	0.510	0.63
2_F	62_E	0.509	0.63
71_G	137_E	0.508	0.63
27_D	147_E	0.507	0.63
8_G	34_N	0.503	0.62
4_T	102_L	0.502	0.62
45_V	86_A	0.500	0.62

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3f2kA	1	0.8805	100	0.245	Contact Map
4mdaA	1	0.8679	100	0.258	Contact Map
4u7bA	2	0.9811	100	0.399	Contact Map
4fcyA	4	0.9371	98.9	0.739	Contact Map
4fw1A	2	0.8742	97.9	0.809	Contact Map
4mq3A	1	0.7925	97.9	0.81	Contact Map
1c6vA	4	0.7799	97.8	0.812	Contact Map
3l3uA	2	0.8365	97.5	0.822	Contact Map
2x78A	2	0.8428	97.5	0.825	Contact Map
3hphA	3	0.8491	97.4	0.826	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.007 seconds.