Q97XI0 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97XI0 - Orf in partial transposon ISC1904

UniProt:	Q97XI0	Sequences: MLRPKEACQRLGISYATLREYVKKGYIKPVILQSGKWRFREEDVEKLMGIVKRRKVVLYARVSSSTQKDDLVNQVKYLEEQVKEYDQVITDIGSGLNMKRKGFLKLLRMILNNEVSRVVIAYPDRLVRFGFEILEEVCKSHNCEIVVINQEDKTPEEELVEDLVSILVLFSGKLYGMRSHEYEKVKKCVEELKA	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	194 (185)
Sequences:	476 (334)
Seq/√Len:	24.5

SULSO - Q97XI0 Q97UQ9 Q97YI6 Q97XQ1 Q97XB5 Q97U52 Q97YH2 Q97U67 Q97YU0 Q97YX0 Q97XZ4 Q97X40 Q97Z60 Q97X25 Q97WZ6 Q97Y49

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
56_V	117_R	4.315	1.00
60_A	78_L	4.140	1.00
82_V	119_V	3.621	1.00
117_R	144_E	3.600	1.00
103_F	126_L	2.688	0.99
58_L	148_I	2.661	0.99
7_A	11_L	2.635	0.99
110_I	138_C	2.614	0.99
13_I	21_Y	2.455	0.98
91_D	102_G	2.451	0.98
17_T	21_Y	2.417	0.98
85_Y	146_V	2.367	0.98
5_K	9_Q	2.329	0.98
106_L	115_V	2.280	0.98
135_E	139_K	2.264	0.97
111_L	141_H	2.203	0.97
16_A	19_R	2.140	0.96
18_L	39_F	1.987	0.94
58_L	78_L	1.930	0.94
22_V	37_W	1.904	0.93
98_M	132_E	1.885	0.93
2_L	7_A	1.853	0.92
3_R	34_S	1.851	0.92
96_L	129_F	1.831	0.92
75_V	90_T	1.780	0.90
58_L	88_V	1.778	0.90
119_V	132_E	1.757	0.90
55_K	109_M	1.741	0.89
77_Y	121_A	1.716	0.89
110_I	118_V	1.710	0.88
22_V	29_P	1.673	0.87
75_V	88_V	1.668	0.87
131_F	145_I	1.647	0.86
87_Q	109_M	1.615	0.85
127_V	131_F	1.612	0.85
110_I	115_V	1.537	0.82
168_V	179_S	1.532	0.82
12_G	142_N	1.519	0.82
27_I	30_V	1.511	0.81
89_I	102_G	1.499	0.81
40_R	43_D	1.482	0.80
98_M	169_L	1.468	0.79
131_F	147_V	1.464	0.79
138_C	143_C	1.455	0.79
119_V	146_V	1.449	0.78
16_A	24_K	1.438	0.78
4_P	19_R	1.436	0.78
169_L	172_G	1.412	0.76
109_M	114_E	1.398	0.76
26_Y	33_Q	1.371	0.74
17_T	20_E	1.360	0.74
31_I	37_W	1.357	0.74
7_A	27_I	1.349	0.73
168_V	172_G	1.341	0.73
96_L	130_G	1.337	0.72
157_E	161_E	1.321	0.71
57_V	75_V	1.288	0.69
91_D	169_L	1.286	0.69
110_I	120_I	1.278	0.69
14_S	20_E	1.241	0.67
7_A	44_V	1.229	0.66
72_V	76_K	1.223	0.65
56_V	144_E	1.203	0.64
107_L	111_L	1.201	0.64
8_C	13_I	1.199	0.64
70_D	73_N	1.189	0.63
64_S	67_Q	1.187	0.63
4_P	18_L	1.180	0.63
76_K	79_E	1.161	0.61
122_Y	161_E	1.157	0.61
22_V	39_F	1.145	0.60
172_G	177_M	1.144	0.60
138_C	174_L	1.140	0.60
62_V	67_Q	1.136	0.60
78_L	148_I	1.133	0.59
15_Y	19_R	1.129	0.59
81_Q	85_Y	1.123	0.59
121_A	180_H	1.116	0.58
95_G	126_L	1.112	0.58
20_E	23_K	1.099	0.57
8_C	15_Y	1.093	0.57
14_S	174_L	1.088	0.56
161_E	172_G	1.086	0.56
67_Q	70_D	1.083	0.56
56_V	119_V	1.083	0.56
22_V	27_I	1.052	0.54
175_Y	178_R	1.048	0.53
58_L	82_V	1.041	0.53
122_Y	153_K	1.041	0.53
54_R	142_N	1.023	0.52
75_V	107_L	1.014	0.51
28_K	43_D	1.013	0.51
62_V	71_L	1.011	0.51
8_C	18_L	0.996	0.50
82_V	85_Y	0.990	0.49
2_L	38_R	0.989	0.49
13_I	20_E	0.987	0.49
89_I	106_L	0.983	0.49
166_I	176_G	0.982	0.49
3_R	38_R	0.977	0.48
8_C	173_K	0.964	0.47
127_V	134_L	0.963	0.47
91_D	121_A	0.958	0.47
39_F	43_D	0.957	0.47
117_R	146_V	0.954	0.47
57_V	89_I	0.950	0.46
172_G	179_S	0.949	0.46
56_V	93_G	0.942	0.46
131_F	134_L	0.937	0.45
89_I	118_V	0.935	0.45
168_V	180_H	0.924	0.44
51_V	147_V	0.915	0.44
43_D	46_K	0.910	0.43
27_I	134_L	0.908	0.43
4_P	29_P	0.892	0.42
68_K	181_E	0.888	0.42
153_K	161_E	0.877	0.41
157_E	160_V	0.876	0.41
4_P	15_Y	0.872	0.41
158_E	170_F	0.862	0.40
110_I	143_C	0.861	0.40
19_R	39_F	0.859	0.40
81_Q	146_V	0.857	0.40
129_F	162_D	0.857	0.40
67_Q	73_N	0.856	0.40
11_L	18_L	0.849	0.39
7_A	18_L	0.844	0.39
26_Y	34_S	0.844	0.39
2_L	11_L	0.838	0.38
138_C	171_S	0.831	0.38
19_R	22_V	0.819	0.37
77_Y	149_N	0.819	0.37
98_M	127_V	0.819	0.37
173_K	177_M	0.818	0.37
42_E	73_N	0.813	0.37
5_K	34_S	0.812	0.37
159_L	168_V	0.804	0.36
179_S	185_V	0.802	0.36
6_E	146_V	0.797	0.36
85_Y	148_I	0.796	0.36
108_R	140_S	0.795	0.36
18_L	22_V	0.789	0.35
7_A	38_R	0.789	0.35
72_V	75_V	0.778	0.34
163_L	167_L	0.778	0.34
22_V	31_I	0.776	0.34
95_G	103_F	0.769	0.34
78_L	151_E	0.767	0.34
139_K	173_K	0.765	0.34
84_E	119_V	0.764	0.34
3_R	33_Q	0.760	0.33
63_S	67_Q	0.757	0.33
73_N	164_V	0.752	0.33
57_V	106_L	0.751	0.33
118_V	145_I	0.751	0.33
44_V	118_V	0.747	0.32
163_L	176_G	0.744	0.32
19_R	36_K	0.740	0.32
70_D	121_A	0.740	0.32
148_I	156_E	0.735	0.32
155_P	177_M	0.731	0.31
93_G	165_S	0.730	0.31
153_K	173_K	0.727	0.31
160_V	163_L	0.727	0.31
64_S	73_N	0.724	0.31
55_K	87_Q	0.721	0.31
107_L	146_V	0.719	0.31
78_L	143_C	0.718	0.31
27_I	43_D	0.713	0.30
121_A	168_V	0.708	0.30
4_P	7_A	0.707	0.30
79_E	88_V	0.704	0.30
97_N	141_H	0.701	0.30
92_I	145_I	0.696	0.29
152_D	167_L	0.691	0.29
100_R	127_V	0.689	0.29
76_K	80_E	0.687	0.29
19_R	31_I	0.683	0.29
34_S	113_N	0.668	0.28
93_G	154_T	0.664	0.28
54_R	143_C	0.663	0.27
81_Q	149_N	0.662	0.27
63_S	128_R	0.653	0.27
9_Q	68_K	0.653	0.27
163_L	166_I	0.652	0.27
8_C	103_F	0.651	0.27
56_V	87_Q	0.647	0.27
13_I	16_A	0.647	0.27
73_N	76_K	0.641	0.26
30_V	38_R	0.640	0.26
162_D	176_G	0.636	0.26
85_Y	121_A	0.633	0.26
118_V	147_V	0.629	0.26
55_K	116_S	0.627	0.25
123_P	167_L	0.625	0.25
96_L	133_I	0.625	0.25
57_V	115_V	0.624	0.25
120_I	145_I	0.624	0.25
111_L	137_V	0.623	0.25
145_I	148_I	0.612	0.25
6_E	159_L	0.611	0.25
64_S	176_G	0.606	0.24
14_S	22_V	0.605	0.24
44_V	48_M	0.603	0.24
50_I	76_K	0.602	0.24
19_R	37_W	0.602	0.24
103_F	127_V	0.600	0.24
33_Q	113_N	0.599	0.24
159_L	162_D	0.597	0.24
77_Y	165_S	0.597	0.24
120_I	162_D	0.596	0.24
118_V	185_V	0.596	0.24
103_F	116_S	0.595	0.24
134_L	138_C	0.594	0.24
147_V	167_L	0.593	0.24
149_N	152_D	0.592	0.24
6_E	43_D	0.591	0.24
3_R	36_K	0.591	0.24
23_K	31_I	0.590	0.23
28_K	47_L	0.589	0.23
129_F	176_G	0.588	0.23
39_F	44_V	0.579	0.23
77_Y	180_H	0.576	0.23
15_Y	37_W	0.576	0.23
134_L	159_L	0.570	0.22
103_F	169_L	0.569	0.22
130_G	171_S	0.566	0.22
129_F	166_I	0.562	0.22
6_E	32_L	0.560	0.22
29_P	43_D	0.557	0.22
16_A	20_E	0.556	0.22
89_I	104_L	0.555	0.22
80_E	105_K	0.552	0.22
134_L	155_P	0.549	0.21
48_M	51_V	0.547	0.21
162_D	166_I	0.547	0.21
171_S	177_M	0.547	0.21
50_I	116_S	0.547	0.21
6_E	57_V	0.546	0.21
54_R	112_N	0.543	0.21
110_I	145_I	0.541	0.21
16_A	36_K	0.540	0.21
30_V	43_D	0.540	0.21
12_G	129_F	0.537	0.21
104_L	136_E	0.536	0.21
119_V	134_L	0.535	0.21
31_I	36_K	0.531	0.21
126_L	133_I	0.529	0.20
13_I	18_L	0.529	0.20
100_R	155_P	0.528	0.20
118_V	126_L	0.528	0.20
101_K	156_E	0.527	0.20
137_V	140_S	0.527	0.20
29_P	39_F	0.527	0.20
4_P	8_C	0.526	0.20
93_G	144_E	0.524	0.20
146_V	152_D	0.522	0.20
22_V	32_L	0.522	0.20
120_I	143_C	0.522	0.20
99_K	173_K	0.516	0.20
183_E	187_K	0.512	0.20
119_V	136_E	0.512	0.20
97_N	106_L	0.508	0.20
154_T	180_H	0.508	0.20
8_C	12_G	0.507	0.19
98_M	103_F	0.507	0.19
99_K	141_H	0.507	0.19
99_K	164_V	0.506	0.19
153_K	158_E	0.505	0.19
101_K	116_S	0.504	0.19
172_G	180_H	0.502	0.19
13_I	38_R	0.502	0.19
23_K	101_K	0.502	0.19
32_L	36_K	0.502	0.19
66_T	122_Y	0.501	0.19
2_L	22_V	0.501	0.19
91_D	145_I	0.501	0.19
179_S	182_Y	0.500	0.19

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3ilxA	2	0.7216	100	0.641	Contact Map
3lhkA	2	0.732	100	0.646	Contact Map
3g13A	2	0.7165	99.8	0.733	Contact Map
3bvpA	4	0.6289	99.8	0.74	Contact Map
3guvA	2	0.6907	99.8	0.747	Contact Map
2mhcA	1	0.5567	99.8	0.75	Contact Map
4bqqA	2	0.6804	99.8	0.751	Contact Map
2gm5A	4	0.6186	99.8	0.753	Contact Map
1gdtA	2	0.6856	99.8	0.757	Contact Map
3pkzA	4	0.5722	99.7	0.759	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0075 seconds.