Q97XB1 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97XB1 - Uncharacterized protein

UniProt:	Q97XB1	Sequences: MVSRYYDWLRQAERNLKSAELNFENGIYEETCYEAQQVAEKSVKSLLSYFHKEMRGHSITFLLQFSSISIPDWILKCAQELDKNYIPSRYPDVYDQGAPLDYYSKDDATSCLECARKILAWVKEIVGTSM	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	130 (117)
Sequences:	461 (426)
Seq/√Len:	39.4

SULSO - Q97XB1 Q97XR7 Q97VT0 Q97XN9

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
20_E	116_R	6.103	1.00
13_E	123_K	4.926	1.00
15_N	41_K	3.359	1.00
105_K	109_T	2.839	1.00
58_S	82_D	2.835	1.00
42_S	119_L	2.610	1.00
18_S	22_N	2.510	1.00
22_N	34_E	2.336	1.00
30_E	34_E	2.249	1.00
84_N	103_Y	2.239	1.00
11_Q	29_E	2.228	0.99
77_C	114_C	2.217	0.99
43_V	59_I	2.105	0.99
68_I	71_P	1.907	0.98
59_I	78_A	1.797	0.98
63_L	78_A	1.771	0.97
113_E	116_R	1.676	0.96
21_L	27_I	1.644	0.96
15_N	34_E	1.615	0.95
21_L	25_N	1.611	0.95
17_K	27_I	1.591	0.95
39_A	81_L	1.554	0.94
46_L	71_P	1.552	0.94
9_L	42_S	1.513	0.94
11_Q	103_Y	1.513	0.94
71_P	121_W	1.470	0.93
13_E	119_L	1.456	0.92
112_L	116_R	1.441	0.92
84_N	111_C	1.440	0.92
14_R	29_E	1.433	0.92
83_K	107_D	1.423	0.91
28_Y	108_A	1.391	0.90
35_A	115_A	1.341	0.89
38_V	112_L	1.274	0.86
31_T	126_V	1.212	0.83
18_S	34_E	1.174	0.81
12_A	76_K	1.155	0.80
18_S	27_I	1.147	0.79
18_S	30_E	1.147	0.79
15_N	22_N	1.141	0.79
59_I	82_D	1.135	0.78
19_A	35_A	1.132	0.78
35_A	113_E	1.127	0.78
12_A	42_S	1.101	0.76
82_D	85_Y	1.097	0.76
104_S	107_D	1.096	0.76
80_E	110_S	1.071	0.74
23_F	108_A	1.070	0.74
22_N	30_E	1.063	0.74
81_L	115_A	1.063	0.74
32_C	111_C	1.040	0.72
41_K	91_P	1.018	0.70
23_F	112_L	0.957	0.66
46_L	67_S	0.948	0.65
82_D	87_P	0.944	0.65
84_N	88_S	0.921	0.63
9_L	45_S	0.919	0.62
47_L	107_D	0.910	0.62
20_E	112_L	0.907	0.61
113_E	117_K	0.902	0.61
7_D	34_E	0.900	0.61
11_Q	99_P	0.897	0.61
116_R	120_A	0.897	0.61
77_C	117_K	0.893	0.60
10_R	101_D	0.892	0.60
37_Q	81_L	0.892	0.60
14_R	22_N	0.889	0.60
36_Q	108_A	0.883	0.59
11_Q	100_L	0.878	0.59
33_Y	85_Y	0.870	0.58
74_I	118_I	0.867	0.58
120_A	124_E	0.855	0.57
5_Y	12_A	0.853	0.57
41_K	55_R	0.840	0.56
23_F	32_C	0.833	0.55
109_T	113_E	0.832	0.55
16_L	115_A	0.831	0.55
36_Q	84_N	0.822	0.54
22_N	41_K	0.809	0.53
107_D	111_C	0.800	0.52
7_D	48_S	0.791	0.51
19_A	112_L	0.790	0.51
73_W	117_K	0.789	0.51
47_L	62_L	0.789	0.51
16_L	20_E	0.778	0.50
14_R	102_Y	0.776	0.50
51_H	82_D	0.775	0.50
38_V	119_L	0.774	0.50
31_T	108_A	0.771	0.49
10_R	70_I	0.769	0.49
44_K	57_H	0.751	0.47
33_Y	89_R	0.748	0.47
87_P	92_D	0.742	0.47
107_D	114_C	0.739	0.46
32_C	107_D	0.730	0.46
15_N	18_S	0.725	0.45
14_R	30_E	0.722	0.45
16_L	51_H	0.720	0.45
103_Y	111_C	0.713	0.44
83_K	104_S	0.713	0.44
46_L	68_I	0.711	0.44
80_E	111_C	0.708	0.44
70_I	121_W	0.707	0.43
47_L	52_K	0.705	0.43
63_L	87_P	0.703	0.43
39_A	118_I	0.699	0.43
28_Y	33_Y	0.699	0.43
23_F	105_K	0.698	0.43
16_L	118_I	0.698	0.43
7_D	56_G	0.695	0.42
8_W	90_Y	0.694	0.42
63_L	71_P	0.689	0.42
27_I	33_Y	0.684	0.41
112_L	119_L	0.683	0.41
46_L	125_I	0.679	0.41
34_E	41_K	0.676	0.41
11_Q	54_M	0.674	0.41
5_Y	45_S	0.669	0.40
85_Y	88_S	0.669	0.40
12_A	38_V	0.666	0.40
67_S	72_D	0.658	0.39
46_L	122_V	0.655	0.39
33_Y	39_A	0.643	0.38
15_N	126_V	0.631	0.37
119_L	123_K	0.630	0.37
17_K	20_E	0.630	0.37
47_L	65_F	0.616	0.36
110_S	113_E	0.614	0.35
56_G	87_P	0.612	0.35
12_A	91_P	0.609	0.35
41_K	99_P	0.607	0.35
27_I	34_E	0.606	0.35
64_Q	70_I	0.604	0.35
78_A	82_D	0.603	0.34
5_Y	49_Y	0.602	0.34
50_F	67_S	0.601	0.34
85_Y	93_V	0.589	0.33
51_H	115_A	0.587	0.33
46_L	50_F	0.574	0.32
32_C	88_S	0.570	0.32
30_E	92_D	0.568	0.32
106_D	118_I	0.568	0.32
20_E	24_E	0.567	0.32
67_S	71_P	0.566	0.32
11_Q	30_E	0.566	0.32
35_A	108_A	0.562	0.31
63_L	74_I	0.559	0.31
25_N	64_Q	0.559	0.31
33_Y	86_I	0.558	0.31
43_V	56_G	0.558	0.31
82_D	86_I	0.557	0.31
5_Y	126_V	0.548	0.30
49_Y	65_F	0.548	0.30
100_L	104_S	0.546	0.30
72_D	106_D	0.545	0.30
77_C	80_E	0.543	0.30
77_C	110_S	0.541	0.30
22_N	62_L	0.536	0.29
39_A	78_A	0.531	0.29
71_P	74_I	0.529	0.29
24_E	68_I	0.528	0.29
37_Q	99_P	0.525	0.28
39_A	69_S	0.523	0.28
52_K	65_F	0.519	0.28
79_Q	103_Y	0.519	0.28
50_F	88_S	0.519	0.28
73_W	118_I	0.517	0.28
43_V	60_T	0.515	0.28
37_Q	115_A	0.512	0.27
99_P	115_A	0.506	0.27
69_S	74_I	0.506	0.27
37_Q	85_Y	0.504	0.27
27_I	30_E	0.502	0.27
36_Q	85_Y	0.501	0.27
11_Q	101_D	0.501	0.27
28_Y	58_S	0.500	0.27

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1ufbA	3	0.9615	100	0.274	Contact Map
3o10A	2	0.9846	100	0.289	Contact Map
1wolA	1	0.9385	100	0.291	Contact Map
1o3uA	2	0.9077	100	0.338	Contact Map
4nqfA	2	0.9462	100	0.38	Contact Map
2hsbA	2	0.9308	99.9	0.422	Contact Map
2jpuA	1	0.8846	89.5	0.88	Contact Map
3mfnA	2	0.9	32.1	0.923	Contact Map
4uqxA	1	0.7769	31.1	0.924	Contact Map
1knyA	2	0.8385	21.7	0.929	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0064 seconds.