Q97X90 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97X90 - Uncharacterized protein

UniProt:	Q97X90	Sequences: MVFKNIVVAYDGSQNAKRALDVAIDLAKRYEAKLTIIEVIDTSVLAGMGLGPIPGEVINEMYNKAKRDVEEAKEKAVNSGVKNVEAVNIEGDPAAAIMDYAGKTGADLIVTGSRGLSTVKRIFLGSVSSRIVHEAKIPVLVVK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	143 (132)
Sequences:	19669 (15789)
Seq/√Len:	1374.3

ECOLI - USPF USPG USPE USPC USPA USPD
BACSU - YXIE NHAX
HALSA - Q9HRP5 Q9HPQ8 Q9HPF7 Q9HPP5 Q9HRD8 Q9HP90 Q9HMI9 Q9HNX9 Q9HHV8 Q9HMJ0 Q9HHX5 Q9HHY0 Q9HMU1
SULSO - Q97X90 Q97V57 Q7LXW4 Q97U40

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
35_T	87_V	3.156	1.00
5_N	35_T	2.829	1.00
7_V	106_A	2.794	1.00
94_A	130_R	2.743	1.00
33_K	85_E	2.681	1.00
22_V	140_L	2.626	1.00
5_N	33_K	2.429	1.00
108_L	140_L	2.383	1.00
87_V	100_Y	2.239	1.00
109_I	137_I	2.007	1.00
111_T	131_I	2.000	1.00
91_G	96_A	1.958	1.00
129_S	133_H	1.944	1.00
35_T	85_E	1.905	1.00
100_Y	104_T	1.897	1.00
35_T	106_A	1.871	1.00
73_K	86_A	1.843	1.00
101_A	109_I	1.834	1.00
35_T	100_Y	1.833	1.00
33_K	83_N	1.778	1.00
89_I	96_A	1.772	1.00
35_T	104_T	1.744	1.00
37_I	100_Y	1.719	1.00
39_V	96_A	1.712	1.00
9_A	111_T	1.687	1.00
21_D	75_K	1.657	1.00
8_V	23_A	1.652	1.00
26_L	30_Y	1.594	1.00
9_A	97_I	1.589	1.00
5_N	107_D	1.556	1.00
96_A	99_D	1.556	1.00
38_E	65_A	1.528	1.00
73_K	77_V	1.495	1.00
17_K	75_K	1.406	1.00
98_M	134_E	1.394	1.00
32_A	107_D	1.390	1.00
130_R	134_E	1.387	1.00
66_K	70_E	1.383	1.00
62_Y	66_K	1.374	1.00
109_I	135_A	1.353	1.00
89_I	100_Y	1.352	1.00
8_V	20_L	1.343	1.00
23_A	27_A	1.341	1.00
101_A	136_K	1.291	1.00
109_I	131_I	1.250	1.00
37_I	89_I	1.202	1.00
135_A	139_V	1.181	1.00
93_P	127_V	1.176	1.00
70_E	73_K	1.149	1.00
65_A	68_D	1.135	1.00
113_S	141_V	1.111	1.00
68_D	72_A	1.108	1.00
119_V	123_F	1.099	1.00
39_V	93_P	1.090	1.00
101_A	137_I	1.086	1.00
121_R	129_S	1.061	1.00
65_A	69_V	1.037	1.00
10_Y	72_A	1.037	1.00
22_V	26_L	1.026	1.00
6_I	108_L	1.007	1.00
111_T	128_S	0.990	1.00
25_D	29_R	0.986	1.00
101_A	106_A	0.965	1.00
70_E	86_A	0.965	1.00
70_E	74_E	0.965	1.00
132_V	141_V	0.955	1.00
98_M	101_A	0.947	1.00
16_A	19_A	0.946	1.00
20_L	36_I	0.943	1.00
69_V	86_A	0.937	1.00
12_G	38_E	0.931	1.00
37_I	97_I	0.924	1.00
58_I	62_Y	0.923	1.00
17_K	71_E	0.921	1.00
5_N	106_A	0.920	1.00
38_E	68_D	0.920	1.00
87_V	104_T	0.914	1.00
5_N	104_T	0.911	1.00
22_V	25_D	0.910	1.00
30_Y	107_D	0.894	1.00
59_N	63_N	0.887	1.00
63_N	67_R	0.884	1.00
40_I	90_E	0.869	1.00
22_V	138_P	0.866	1.00
13_S	16_A	0.865	1.00
100_Y	106_A	0.862	1.00
23_A	110_V	0.859	1.00
40_I	88_N	0.859	1.00
20_L	72_A	0.857	1.00
61_M	64_K	0.854	1.00
128_S	141_V	0.854	1.00
116_L	120_K	0.852	1.00
68_D	71_E	0.851	1.00
10_Y	19_A	0.831	1.00
22_V	142_V	0.814	1.00
113_S	128_S	0.814	1.00
36_I	84_V	0.813	1.00
53_I	56_E	0.809	1.00
63_N	66_K	0.806	1.00
54_P	57_V	0.805	1.00
28_K	80_G	0.801	1.00
72_A	75_K	0.793	1.00
75_K	78_N	0.792	1.00
98_M	131_I	0.789	1.00
67_R	71_E	0.787	1.00
7_V	109_I	0.782	1.00
71_E	75_K	0.778	1.00
24_I	79_S	0.776	1.00
24_I	76_A	0.773	1.00
23_A	34_L	0.770	1.00
10_Y	36_I	0.769	1.00
20_L	24_I	0.765	1.00
92_D	95_A	0.759	1.00
10_Y	20_L	0.755	1.00
27_A	34_L	0.755	1.00
36_I	72_A	0.753	1.00
110_V	140_L	0.751	1.00
9_A	112_G	0.748	1.00
118_T	121_R	0.737	1.00
7_V	37_I	0.730	1.00
13_S	115_G	0.728	1.00
98_M	135_A	0.727	1.00
65_A	88_N	0.722	1.00
77_V	80_G	0.721	1.00
71_E	74_E	0.713	1.00
18_R	21_D	0.712	1.00
60_E	64_K	0.712	1.00
119_V	122_I	0.709	1.00
28_K	79_S	0.708	1.00
72_A	76_A	0.704	1.00
10_Y	17_K	0.701	1.00
75_K	79_S	0.694	1.00
97_I	131_I	0.694	1.00
64_K	67_R	0.693	1.00
55_G	59_N	0.689	1.00
62_Y	90_E	0.689	1.00
17_K	21_D	0.688	1.00
26_L	29_R	0.687	1.00
74_E	78_N	0.684	1.00
27_A	32_A	0.682	1.00
8_V	34_L	0.674	1.00
74_E	77_V	0.672	1.00
40_I	65_A	0.668	1.00
56_E	60_E	0.665	1.00
27_A	30_Y	0.658	1.00
61_M	65_A	0.657	1.00
118_T	122_I	0.655	1.00
69_V	73_K	0.653	1.00
64_K	68_D	0.650	1.00
115_G	124_L	0.649	1.00
7_V	100_Y	0.649	1.00
25_D	28_K	0.646	1.00
17_K	72_A	0.645	1.00
60_E	63_N	0.639	1.00
124_L	128_S	0.636	1.00
110_V	142_V	0.636	1.00
105_G	137_I	0.634	1.00
57_V	60_E	0.629	1.00
96_A	100_Y	0.627	1.00
36_I	76_A	0.626	1.00
10_Y	16_A	0.618	1.00
52_P	56_E	0.615	1.00
66_K	86_A	0.615	1.00
76_A	79_S	0.612	1.00
94_A	127_V	0.607	1.00
24_I	81_V	0.599	1.00
12_G	68_D	0.599	1.00
6_I	110_V	0.598	1.00
73_K	84_V	0.597	1.00
111_T	141_V	0.596	1.00
76_A	84_V	0.589	1.00
76_A	80_G	0.586	1.00
94_A	98_M	0.582	1.00
37_I	96_A	0.581	1.00
24_I	28_K	0.565	1.00
23_A	32_A	0.561	1.00
55_G	58_I	0.556	1.00
56_E	59_N	0.556	1.00
14_Q	17_K	0.551	1.00
12_G	72_A	0.550	1.00
40_I	62_Y	0.547	1.00
113_S	123_F	0.545	1.00
6_I	27_A	0.544	1.00
15_N	18_R	0.542	1.00
78_N	81_V	0.538	1.00
132_V	139_V	0.536	1.00
95_A	99_D	0.523	1.00
59_N	62_Y	0.521	1.00
26_L	110_V	0.520	1.00
91_G	99_D	0.520	1.00
114_R	128_S	0.519	1.00
8_V	19_A	0.518	1.00
94_A	131_I	0.518	1.00
5_N	32_A	0.517	1.00
131_I	139_V	0.511	1.00
94_A	134_E	0.503	1.00
25_D	79_S	0.500	1.00
58_I	90_E	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3s3tA	4	1	99.9	0.11	Contact Map
4wnyA	2	0.8881	99.9	0.113	Contact Map
5ahwA	4	1	99.9	0.126	Contact Map
1mjhA	2	0.958	99.9	0.128	Contact Map
2dumA	2	0.951	99.9	0.136	Contact Map
3hgmA	2	0.979	99.9	0.151	Contact Map
3loqA	1	0.951	99.9	0.154	Contact Map
3fg9A	3	0.979	99.9	0.157	Contact Map
2gm3A	2	0.8671	99.9	0.162	Contact Map
3tnjA	2	0.8601	99.9	0.166	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0068 seconds.