Q97X89 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97X89 - Uncharacterized protein

UniProt:	Q97X89	Sequences: MNKKEKGEWKKKIIQGLHEVYDPEIPIDIVNLGLIYQLDISDEGDVYVRIGATTPACPVTEDLEYTVEQVVKESVQAKSIKVELDLETEWTPLMMTDEGRKEFIRKFGYDIVKRWAERMGIKLEEEKVT	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	129 (99)
Sequences:	2386 (1334)
Seq/√Len:	134.0

ECOLI - PAAD
BACSU - YITW
SULSO - Q97X89 Q7LXS9 Q97YS5

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
28_D	31_N	4.211	1.00
37_Q	49_R	3.032	1.00
47_Y	81_K	2.762	1.00
49_R	83_E	2.578	1.00
45_D	79_S	2.494	1.00
91_T	94_M	2.222	1.00
68_E	72_K	2.203	1.00
49_R	85_D	2.201	1.00
101_K	104_I	2.113	1.00
95_M	99_G	2.086	1.00
40_I	46_V	2.005	1.00
50_I	67_V	2.000	1.00
47_Y	83_E	1.960	1.00
45_D	78_K	1.857	1.00
34_L	63_L	1.828	1.00
41_S	45_D	1.778	1.00
14_I	30_V	1.775	1.00
48_V	71_V	1.675	1.00
29_I	35_I	1.674	1.00
45_D	81_K	1.650	1.00
18_H	98_E	1.469	1.00
31_N	99_G	1.459	1.00
29_I	63_L	1.433	1.00
30_V	35_I	1.367	1.00
12_K	15_Q	1.356	1.00
41_S	47_Y	1.336	1.00
62_D	66_T	1.309	1.00
85_D	88_T	1.307	1.00
66_T	69_Q	1.297	1.00
36_Y	94_M	1.294	1.00
98_E	102_E	1.287	1.00
19_E	70_V	1.257	1.00
72_K	80_I	1.254	1.00
21_Y	26_P	1.207	1.00
20_V	70_V	1.197	1.00
51_G	88_T	1.194	0.99
52_A	59_V	1.175	0.99
17_L	30_V	1.163	0.99
65_Y	68_E	1.125	0.99
7_G	10_K	1.119	0.99
18_H	28_D	1.118	0.99
12_K	76_Q	1.117	0.99
11_K	15_Q	1.111	0.99
17_L	35_I	1.107	0.99
64_E	68_E	1.100	0.99
96_T	99_G	1.089	0.99
50_I	60_T	1.071	0.99
101_K	105_R	1.062	0.99
71_V	74_S	1.061	0.99
16_G	70_V	1.055	0.99
93_L	103_F	0.997	0.98
39_D	49_R	0.994	0.98
31_N	102_E	0.968	0.98
21_Y	25_I	0.963	0.98
61_E	66_T	0.958	0.98
18_H	31_N	0.947	0.97
64_E	84_L	0.928	0.97
10_K	14_I	0.928	0.97
17_L	67_V	0.925	0.97
39_D	47_Y	0.921	0.97
65_Y	69_Q	0.919	0.97
64_E	82_V	0.911	0.97
44_G	78_K	0.900	0.96
26_P	59_V	0.883	0.96
16_G	75_V	0.881	0.96
16_G	20_V	0.863	0.96
98_E	101_K	0.852	0.95
60_T	63_L	0.844	0.95
26_P	54_T	0.834	0.95
92_P	100_R	0.825	0.94
8_E	12_K	0.822	0.94
13_I	71_V	0.818	0.94
97_D	101_K	0.815	0.94
31_N	98_E	0.803	0.93
43_E	78_K	0.781	0.92
72_K	78_K	0.775	0.92
99_G	104_I	0.758	0.91
36_Y	51_G	0.751	0.91
72_K	79_S	0.742	0.90
9_W	12_K	0.740	0.90
63_L	92_P	0.735	0.90
10_K	38_L	0.726	0.89
18_H	30_V	0.725	0.89
35_I	67_V	0.725	0.89
16_G	77_A	0.716	0.89
20_V	29_I	0.711	0.88
63_L	66_T	0.708	0.88
7_G	11_K	0.707	0.88
16_G	74_S	0.703	0.88
86_L	89_E	0.703	0.88
66_T	70_V	0.703	0.88
58_P	70_V	0.693	0.87
34_L	50_I	0.692	0.87
12_K	75_V	0.687	0.87
54_T	92_P	0.685	0.87
38_L	58_P	0.676	0.86
46_V	77_A	0.675	0.86
70_V	73_E	0.672	0.86
36_Y	88_T	0.671	0.85
54_T	59_V	0.667	0.85
60_T	64_E	0.644	0.83
35_I	60_T	0.630	0.82
21_Y	28_D	0.630	0.82
26_P	92_P	0.630	0.82
52_A	86_L	0.628	0.82
34_L	52_A	0.628	0.82
71_V	80_I	0.622	0.81
67_V	82_V	0.619	0.81
27_I	52_A	0.619	0.81
99_G	105_R	0.612	0.80
77_A	80_I	0.604	0.79
42_D	45_D	0.598	0.78
55_P	94_M	0.598	0.78
16_G	73_E	0.593	0.78
37_Q	85_D	0.592	0.78
20_V	58_P	0.591	0.77
37_Q	47_Y	0.589	0.77
48_V	80_I	0.587	0.77
21_Y	34_L	0.585	0.77
54_T	60_T	0.584	0.77
39_D	97_D	0.583	0.77
95_M	103_F	0.577	0.76
26_P	55_P	0.577	0.76
72_K	75_V	0.577	0.76
9_W	40_I	0.574	0.75
25_I	104_I	0.571	0.75
50_I	86_L	0.565	0.74
34_L	60_T	0.564	0.74
68_E	81_K	0.563	0.74
54_T	58_P	0.559	0.73
46_V	71_V	0.552	0.73
36_Y	85_D	0.546	0.72
33_G	53_T	0.545	0.72
61_E	64_E	0.544	0.71
29_I	85_D	0.544	0.71
24_E	33_G	0.538	0.71
55_P	86_L	0.533	0.70
11_K	47_Y	0.529	0.69
10_K	37_Q	0.527	0.69
8_E	11_K	0.526	0.69
38_L	46_V	0.523	0.69
52_A	56_A	0.522	0.68
51_G	94_M	0.513	0.67
15_Q	18_H	0.513	0.67
16_G	19_E	0.511	0.67
9_W	77_A	0.509	0.66
41_S	72_K	0.504	0.66
60_T	82_V	0.500	0.65

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3lnoA	1	0.8062	100	0.355	Contact Map
1uwdA	1	0.7907	100	0.38	Contact Map
3cq1A	2	0.7674	100	0.387	Contact Map
3ux2A	2	0.907	99.9	0.424	Contact Map
2m5oA	1	0.6589	92.5	0.877	Contact Map
1vehA	1	0.6589	89.2	0.886	Contact Map
1xhjA	1	0.6667	81.9	0.897	Contact Map
2z51A	2	0.8992	51.9	0.917	Contact Map
3w61A	2	0.5891	35.6	0.924	Contact Map
1yg0A	1	0.4884	33.2	0.926	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0058 seconds.