Q97X88 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97X88 - Uncharacterized protein

UniProt:	Q97X88	Sequences: MIKLKRVYDPIERDDGIRILVDRLWPRGIGKDKVDLWLKDIAPSDELRKWFSHDTSKWDEFKKKYFEELDANPKISVLLQLIKKGENITLLYASKSPYNNAVALKEYLEKKILKQ	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	115 (109)
Sequences:	1535 (1196)
Seq/√Len:	114.5

ECOLI - YEAO
SULSO - Q97X88

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
105_K	109_E	3.521	1.00
7_V	91_L	3.400	1.00
30_G	33_K	2.854	1.00
54_D	57_K	2.530	1.00
5_K	15_D	2.391	1.00
50_W	64_K	2.385	1.00
66_F	103_A	2.197	1.00
62_K	106_E	2.194	1.00
5_K	89_T	2.061	1.00
62_K	66_F	1.972	1.00
15_D	89_T	1.942	1.00
92_Y	99_N	1.925	1.00
99_N	102_V	1.908	1.00
45_D	100_N	1.838	1.00
3_K	87_N	1.834	1.00
70_D	107_Y	1.815	1.00
90_L	108_L	1.803	1.00
66_F	110_K	1.793	1.00
45_D	49_K	1.677	1.00
22_D	100_N	1.596	1.00
58_W	62_K	1.587	1.00
17_I	36_L	1.569	1.00
75_I	78_L	1.557	1.00
17_I	35_D	1.524	1.00
60_E	64_K	1.500	1.00
42_A	100_N	1.458	1.00
52_S	57_K	1.423	1.00
4_L	101_A	1.361	1.00
53_H	57_K	1.347	1.00
58_W	103_A	1.339	1.00
47_L	50_W	1.319	1.00
38_L	42_A	1.310	1.00
93_A	100_N	1.283	0.99
92_Y	101_A	1.258	0.99
50_W	57_K	1.255	0.99
5_K	18_R	1.233	0.99
7_V	34_V	1.225	0.99
100_N	103_A	1.203	0.99
94_S	99_N	1.201	0.99
16_G	89_T	1.197	0.99
78_L	82_I	1.192	0.99
44_S	68_E	1.176	0.99
34_V	91_L	1.162	0.99
60_E	63_K	1.162	0.99
80_Q	83_K	1.161	0.99
38_L	41_I	1.157	0.99
50_W	56_S	1.153	0.99
51_F	98_Y	1.133	0.99
7_V	29_I	1.110	0.98
17_I	86_E	1.106	0.98
15_D	18_R	1.106	0.98
51_F	99_N	1.076	0.98
5_K	16_G	1.070	0.98
77_V	80_Q	1.070	0.98
51_F	92_Y	1.058	0.98
22_D	93_A	1.053	0.98
75_I	107_Y	1.036	0.98
24_L	100_N	1.026	0.97
67_E	71_A	1.020	0.97
38_L	78_L	1.019	0.97
78_L	81_L	0.990	0.97
31_K	95_K	0.976	0.96
4_L	105_K	0.972	0.96
22_D	95_K	0.961	0.96
92_Y	102_V	0.949	0.96
76_S	80_Q	0.946	0.96
2_I	88_I	0.944	0.96
75_I	79_L	0.918	0.95
19_I	36_L	0.904	0.95
76_S	79_L	0.884	0.94
67_E	70_D	0.876	0.94
19_I	82_I	0.851	0.93
11_I	15_D	0.841	0.92
72_N	76_S	0.839	0.92
24_L	48_R	0.834	0.92
55_T	96_S	0.830	0.92
3_K	14_D	0.827	0.92
74_K	78_L	0.823	0.91
71_A	74_K	0.819	0.91
30_G	34_V	0.812	0.91
36_L	78_L	0.807	0.91
57_K	60_E	0.806	0.91
78_L	83_K	0.794	0.90
50_W	60_E	0.788	0.90
46_E	49_K	0.785	0.89
76_S	107_Y	0.784	0.89
49_K	95_K	0.782	0.89
15_D	87_N	0.781	0.89
53_H	94_S	0.775	0.89
66_F	106_E	0.770	0.88
51_F	94_S	0.767	0.88
58_W	102_V	0.763	0.88
72_N	75_I	0.763	0.88
20_L	26_P	0.761	0.88
17_I	82_I	0.749	0.87
5_K	12_E	0.748	0.87
5_K	11_I	0.735	0.86
23_R	45_D	0.725	0.85
18_R	34_V	0.715	0.84
10_P	21_V	0.713	0.84
24_L	45_D	0.707	0.84
53_H	98_Y	0.695	0.83
42_A	53_H	0.694	0.83
63_K	67_E	0.692	0.82
77_V	81_L	0.692	0.82
53_H	56_S	0.691	0.82
20_L	34_V	0.683	0.82
19_I	79_L	0.678	0.81
12_E	15_D	0.678	0.81
14_D	87_N	0.676	0.81
81_L	84_K	0.675	0.81
74_K	77_V	0.672	0.81
34_V	88_I	0.651	0.78
10_P	18_R	0.646	0.78
94_S	101_A	0.646	0.78
58_W	99_N	0.644	0.78
22_D	94_S	0.644	0.78
92_Y	96_S	0.642	0.78
19_I	38_L	0.638	0.77
17_I	38_L	0.634	0.77
91_L	101_A	0.634	0.77
11_I	89_T	0.629	0.76
24_L	39_K	0.612	0.74
103_A	107_Y	0.612	0.74
19_I	88_I	0.605	0.73
102_V	105_K	0.605	0.73
59_D	73_P	0.604	0.73
55_T	98_Y	0.603	0.73
21_V	101_A	0.599	0.73
21_V	104_L	0.599	0.73
58_W	98_Y	0.597	0.72
106_E	109_E	0.590	0.71
31_K	48_R	0.589	0.71
22_D	90_L	0.589	0.71
41_I	76_S	0.588	0.71
62_K	103_A	0.583	0.71
47_L	60_E	0.577	0.70
36_L	81_L	0.577	0.70
45_D	51_F	0.575	0.69
50_W	54_D	0.572	0.69
20_L	104_L	0.564	0.68
31_K	39_K	0.564	0.68
81_L	85_G	0.559	0.67
29_I	91_L	0.558	0.67
2_I	83_K	0.557	0.67
66_F	107_Y	0.551	0.66
51_F	102_V	0.544	0.65
58_W	107_Y	0.543	0.65
5_K	10_P	0.531	0.63
46_E	64_K	0.531	0.63
66_F	70_D	0.529	0.63
78_L	88_I	0.529	0.63
47_L	64_K	0.526	0.63
52_S	98_Y	0.525	0.63
106_E	110_K	0.524	0.62
29_I	85_G	0.524	0.62
31_K	77_V	0.522	0.62
12_E	60_E	0.517	0.61
83_K	86_E	0.512	0.61
80_Q	84_K	0.511	0.60
20_L	25_W	0.509	0.60
83_K	88_I	0.504	0.59
31_K	49_K	0.502	0.59
79_L	88_I	0.500	0.59

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2gqrA	2	0.5043	21.2	0.939	Contact Map
4zu2A	3	0.7739	20.1	0.939	Contact Map
2ywvA	2	0.513	11.7	0.946	Contact Map
3nuaA	2	0.4783	11.2	0.946	Contact Map
2cxnA	2	0.7565	9.5	0.948	Contact Map
2lxeA	1	0.3217	9.5	0.948	Contact Map
3kreA	2	0.513	8.2	0.949	Contact Map
4izbA	5	0.6435	7.3	0.95	Contact Map
4wywA	1	0.7652	6	0.952	Contact Map
4q1kA	3	0.7913	5.7	0.953	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0058 seconds.