Q97X40 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97X40 - First ORF in transposon ISC1913

UniProt:	Q97X40	Sequences: MERLLRPKEACQLLGISYSTLLRWIREGKIRVVTTEGGKYRIPYSEIKKYLEKREETRAVIYARVSSTDQREDLERQINYLTNYATAKGYKVVEVLKDIASGLNTQRKGLLKLFKLVEGRSVDIVLITYKDRLTRFGFEYIEEFFSTMGVKIEVVFGEEPKDDAQELVEDLISIITSFAGKIYGMRSHKKTLLVQGVKKLIGELSGEDSEVKG	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	213 (192)
Sequences:	470 (329)
Seq/√Len:	23.7

SULSO - Q97X40 Q97XI0 Q97UQ9 Q97XQ1 Q97U52 Q97YH2 Q97XB5 Q97YI6 Q97U67 Q97YU0 Q97YX0 Q97XZ4 Q97X25 Q97Z60 Q97WZ6

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
59_A	124_I	4.113	1.00
63_A	81_L	4.078	1.00
124_I	151_K	3.784	1.00
85_A	126_L	3.471	1.00
117_V	145_F	3.077	1.00
110_L	133_L	2.929	1.00
10_A	14_L	2.856	0.99
90_Y	153_E	2.537	0.99
20_T	24_W	2.463	0.98
61_I	155_V	2.455	0.98
98_D	109_G	2.400	0.98
5_L	10_A	2.357	0.98
16_I	24_W	2.319	0.98
8_K	12_Q	2.267	0.97
105_T	139_E	2.171	0.96
61_I	81_L	2.133	0.96
118_E	148_M	2.093	0.95
19_S	22_L	2.054	0.95
78_I	97_K	2.049	0.95
113_L	122_V	2.036	0.95
142_E	146_S	2.020	0.94
21_L	42_I	1.980	0.94
126_L	139_E	1.935	0.93
6_R	37_G	1.917	0.93
78_I	95_V	1.879	0.92
25_I	40_Y	1.877	0.92
117_V	122_V	1.833	0.91
80_Y	128_T	1.808	0.90
19_S	27_E	1.785	0.90
84_Y	89_G	1.712	0.88
96_L	109_G	1.706	0.87
117_V	125_V	1.704	0.87
138_F	152_I	1.678	0.87
134_T	138_F	1.623	0.85
10_A	47_I	1.587	0.83
103_L	136_F	1.559	0.82
58_R	116_L	1.530	0.81
94_E	116_L	1.522	0.81
105_T	177_S	1.519	0.80
84_Y	88_K	1.503	0.80
25_I	32_V	1.479	0.79
7_P	22_L	1.466	0.78
59_A	151_K	1.452	0.77
61_I	95_V	1.446	0.77
138_F	154_V	1.431	0.76
17_S	23_R	1.428	0.76
103_L	137_G	1.425	0.76
33_V	41_R	1.416	0.75
116_L	121_S	1.397	0.74
145_F	150_V	1.390	0.74
20_T	23_R	1.384	0.74
73_D	76_R	1.375	0.73
15_G	149_G	1.367	0.73
129_Y	169_E	1.351	0.72
176_T	187_S	1.348	0.72
183_Y	186_R	1.347	0.72
75_E	79_N	1.342	0.71
65_V	70_Q	1.333	0.71
145_F	182_I	1.322	0.70
126_L	153_E	1.318	0.70
34_T	40_Y	1.301	0.69
25_I	30_I	1.282	0.68
23_R	26_R	1.260	0.66
117_V	127_I	1.242	0.65
88_K	153_E	1.227	0.64
6_R	41_R	1.225	0.64
177_S	180_G	1.223	0.64
43_P	46_E	1.219	0.64
29_K	36_E	1.203	0.63
96_L	125_V	1.190	0.62
165_Q	169_E	1.189	0.62
79_N	82_T	1.174	0.61
7_P	21_L	1.162	0.60
30_I	33_V	1.132	0.58
127_I	154_V	1.128	0.58
11_C	16_I	1.122	0.57
10_A	30_I	1.114	0.57
81_L	155_V	1.113	0.57
136_F	170_D	1.106	0.56
18_Y	22_L	1.105	0.56
11_C	18_Y	1.104	0.56
98_D	177_S	1.093	0.55
5_L	13_L	1.081	0.54
145_F	179_A	1.081	0.54
25_I	42_I	1.077	0.54
115_K	147_T	1.073	0.54
128_T	188_H	1.072	0.54
67_S	70_Q	1.065	0.53
30_I	46_E	1.062	0.53
150_V	197_V	1.062	0.53
96_L	113_L	1.053	0.52
87_A	126_L	1.028	0.51
11_C	21_L	1.018	0.50
161_K	181_K	1.017	0.50
174_I	184_G	0.999	0.49
176_T	180_G	0.991	0.48
125_V	133_L	0.991	0.48
59_A	126_L	0.982	0.47
117_V	150_V	0.956	0.46
60_V	96_L	0.950	0.45
137_G	179_A	0.949	0.45
124_I	153_E	0.948	0.45
88_K	126_L	0.946	0.45
61_I	85_A	0.932	0.44
141_I	145_F	0.932	0.44
129_Y	161_K	0.927	0.44
90_Y	93_V	0.921	0.43
17_S	182_I	0.920	0.43
7_P	32_V	0.914	0.43
76_R	172_I	0.913	0.43
60_V	78_I	0.909	0.42
16_I	23_R	0.907	0.42
58_R	94_E	0.895	0.41
166_E	178_F	0.895	0.41
21_L	25_I	0.888	0.41
59_A	100_A	0.885	0.41
11_C	181_K	0.881	0.40
98_D	128_T	0.875	0.40
80_Y	98_D	0.871	0.40
84_Y	153_E	0.869	0.40
80_Y	156_F	0.867	0.39
6_R	36_E	0.866	0.39
105_T	134_T	0.864	0.39
75_E	78_I	0.862	0.39
180_G	185_M	0.862	0.39
10_A	21_L	0.860	0.39
22_L	25_I	0.850	0.38
22_L	34_T	0.845	0.38
78_I	114_F	0.841	0.38
171_L	184_G	0.840	0.38
169_E	180_G	0.838	0.37
22_L	42_I	0.836	0.37
25_I	34_T	0.834	0.37
110_L	177_S	0.831	0.37
60_V	122_V	0.830	0.37
125_V	152_I	0.828	0.37
29_K	37_G	0.828	0.37
134_T	141_I	0.827	0.37
102_G	133_L	0.823	0.36
9_E	167_L	0.814	0.36
138_F	141_I	0.813	0.36
46_E	49_K	0.811	0.36
128_T	176_T	0.808	0.36
107_R	134_T	0.806	0.35
7_P	18_Y	0.804	0.35
8_K	37_G	0.797	0.35
14_L	21_L	0.794	0.35
161_K	169_E	0.779	0.34
100_A	162_D	0.779	0.34
136_F	174_I	0.777	0.34
60_V	113_L	0.776	0.33
31_R	46_E	0.772	0.33
181_K	185_M	0.760	0.32
39_K	42_I	0.759	0.32
61_I	92_V	0.757	0.32
6_R	9_E	0.755	0.32
70_Q	73_D	0.754	0.32
10_A	41_R	0.752	0.32
17_S	25_I	0.750	0.32
51_L	54_R	0.748	0.32
33_V	39_K	0.747	0.32
22_L	39_K	0.746	0.32
54_R	154_V	0.744	0.31
108_K	164_A	0.741	0.31
5_L	41_R	0.738	0.31
142_E	159_E	0.738	0.31
191_T	194_V	0.737	0.31
100_A	173_S	0.736	0.31
26_R	34_T	0.735	0.31
76_R	79_N	0.730	0.31
65_V	74_L	0.728	0.31
168_V	171_L	0.728	0.31
5_L	14_L	0.726	0.30
103_L	140_Y	0.721	0.30
146_S	181_K	0.720	0.30
57_T	150_V	0.718	0.30
5_L	51_L	0.715	0.30
7_P	11_C	0.713	0.30
71_R	189_K	0.713	0.30
170_D	184_G	0.710	0.29
75_E	194_V	0.697	0.29
118_E	144_F	0.694	0.29
82_T	95_V	0.692	0.28
161_K	166_E	0.691	0.28
104_N	148_M	0.691	0.28
30_I	141_I	0.684	0.28
28_G	137_G	0.681	0.28
167_L	176_T	0.680	0.28
57_T	149_G	0.668	0.27
70_Q	76_R	0.668	0.27
45_S	76_R	0.667	0.27
66_S	70_Q	0.657	0.26
102_G	110_L	0.654	0.26
32_V	42_I	0.652	0.26
92_V	155_V	0.651	0.26
181_K	184_G	0.648	0.26
73_D	128_T	0.647	0.26
53_K	114_F	0.647	0.26
99_I	152_I	0.641	0.26
24_W	167_L	0.640	0.26
9_E	60_V	0.640	0.26
29_K	175_I	0.632	0.25
16_I	34_T	0.631	0.25
11_C	127_I	0.630	0.25
8_K	11_C	0.630	0.25
9_E	46_E	0.626	0.25
96_L	116_L	0.623	0.25
38_G	97_K	0.620	0.24
85_A	92_V	0.619	0.24
26_R	108_K	0.616	0.24
60_V	157_G	0.616	0.24
141_I	163_D	0.612	0.24
67_S	76_R	0.610	0.24
42_I	46_E	0.609	0.24
79_N	83_N	0.607	0.24
106_Q	181_K	0.605	0.24
171_L	175_I	0.604	0.24
7_P	10_A	0.601	0.23
126_L	143_E	0.599	0.23
92_V	149_G	0.599	0.23
107_R	163_D	0.595	0.23
33_V	43_P	0.591	0.23
8_K	22_L	0.587	0.23
12_Q	15_G	0.586	0.23
130_K	175_I	0.585	0.23
162_D	188_H	0.579	0.22
22_L	40_Y	0.579	0.22
13_L	97_K	0.578	0.22
5_L	138_F	0.577	0.22
114_F	153_E	0.576	0.22
80_Y	173_S	0.572	0.22
180_G	187_S	0.569	0.22
90_Y	126_L	0.564	0.22
67_S	171_L	0.564	0.22
98_D	152_I	0.561	0.22
57_T	119_G	0.560	0.21
42_I	47_I	0.558	0.21
31_R	50_Y	0.558	0.21
98_D	193_L	0.555	0.21
111_L	141_I	0.555	0.21
18_Y	40_Y	0.553	0.21
94_E	158_E	0.552	0.21
93_V	107_R	0.551	0.21
66_S	135_R	0.546	0.21
47_I	125_V	0.546	0.21
179_A	185_M	0.544	0.21
37_G	120_R	0.541	0.21
37_G	84_Y	0.540	0.21
14_L	98_D	0.537	0.20
11_C	110_L	0.537	0.20
9_E	153_E	0.535	0.20
29_K	54_R	0.535	0.20
50_Y	147_T	0.534	0.20
9_E	13_L	0.533	0.20
110_L	134_T	0.532	0.20
51_L	115_K	0.532	0.20
170_D	174_I	0.530	0.20
142_E	153_E	0.529	0.20
93_V	153_E	0.528	0.20
67_S	127_I	0.526	0.20
163_D	185_M	0.526	0.20
127_I	170_D	0.525	0.20
136_F	184_G	0.524	0.20
47_I	57_T	0.524	0.20
15_G	136_F	0.522	0.20
90_Y	124_I	0.521	0.20
19_S	23_R	0.520	0.20
84_Y	124_I	0.520	0.20
11_C	15_G	0.520	0.20
118_E	140_Y	0.519	0.20
24_W	41_R	0.516	0.19
148_M	152_I	0.515	0.19
101_S	161_K	0.513	0.19
17_S	27_E	0.510	0.19
81_L	150_V	0.510	0.19
165_Q	168_V	0.510	0.19
127_I	149_G	0.509	0.19
84_Y	156_F	0.508	0.19
100_A	151_K	0.508	0.19
176_T	188_H	0.506	0.19
25_I	172_I	0.504	0.19
42_I	177_S	0.503	0.19
25_I	37_G	0.501	0.19
42_I	130_K	0.501	0.19
5_L	22_L	0.501	0.19
69_D	129_Y	0.501	0.19
125_V	154_V	0.500	0.19
99_I	107_R	0.500	0.19

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3lhkA	2	0.6854	100	0.605	Contact Map
3ilxA	2	0.6573	100	0.641	Contact Map
3bvpA	4	0.6009	99.9	0.693	Contact Map
3g13A	2	0.7042	99.9	0.694	Contact Map
3guvA	2	0.6573	99.9	0.698	Contact Map
4bqqA	2	0.723	99.9	0.71	Contact Map
2mhcA	1	0.5258	99.9	0.713	Contact Map
2gm5A	4	0.5681	99.9	0.721	Contact Map
1gdtA	2	0.6995	99.9	0.732	Contact Map
3pkzA	4	0.5258	99.8	0.744	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0079 seconds.