Q97X30 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97X30 - dTDP-4-dehydrorhamnose 3,5 epimerase (RfbC-2)

UniProt:	Q97X30	Sequences: MPFEFENLGMGIVLIKPKVFPDKRGFFLEVFKSEDFTKAEIPNIVQTNMSFSFKGVVRGLHYQITPKEQGKLVFVPKGKILDVALDLRKSSPTFGKYVKVELNDENHYILWIPPGFAHGFQALEDSIVVYFLTHNEYSKSDERCVNYSYVDWPIKEFIISDKDSQCPPLEKADVFN	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	176 (166)
Sequences:	4407 (2824)
Seq/√Len:	219.1

ECOLI - RMLC
BACSU - SPSL
SULSO - Q97X30 Q7LXE5

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
144_C	166_C	3.400	1.00
79_K	101_E	3.245	1.00
33_S	43_N	3.238	1.00
124_E	127_I	2.837	1.00
16_K	108_Y	2.567	1.00
80_I	129_V	2.565	1.00
6_E	13_V	2.415	1.00
8_L	98_V	2.407	1.00
138_S	141_D	2.369	1.00
60_L	117_A	2.347	1.00
70_G	111_W	2.333	1.00
64_I	143_R	2.319	1.00
81_L	99_K	2.221	1.00
50_S	120_F	2.196	1.00
37_T	42_P	2.180	1.00
47_T	132_L	2.176	1.00
57_V	121_Q	2.103	1.00
77_K	104_D	2.060	1.00
54_K	125_D	2.021	1.00
70_G	134_H	2.007	1.00
34_E	136_E	2.000	1.00
8_L	96_K	1.971	1.00
33_S	37_T	1.960	1.00
76_P	130_Y	1.904	1.00
114_P	134_H	1.883	1.00
77_K	126_S	1.870	1.00
146_N	168_P	1.858	1.00
67_K	138_S	1.833	1.00
14_L	108_Y	1.808	1.00
77_K	128_V	1.770	1.00
168_P	171_K	1.749	1.00
161_D	165_Q	1.735	1.00
79_K	124_E	1.722	1.00
51_F	128_V	1.707	1.00
103_N	106_N	1.650	1.00
49_M	128_V	1.641	1.00
161_D	164_S	1.640	1.00
9_G	116_F	1.631	1.00
81_L	153_P	1.616	1.00
70_G	114_P	1.614	1.00
87_L	117_A	1.597	1.00
14_L	100_V	1.576	1.00
67_K	135_N	1.535	1.00
60_L	119_G	1.507	1.00
62_Y	143_R	1.498	1.00
34_E	38_K	1.494	1.00
12_I	84_A	1.485	1.00
49_M	74_F	1.485	1.00
79_K	103_N	1.461	1.00
7_N	14_L	1.435	1.00
19_V	107_H	1.371	1.00
122_A	127_I	1.365	1.00
6_E	10_M	1.362	1.00
62_Y	172_A	1.302	1.00
80_I	127_I	1.290	1.00
26_F	51_F	1.250	1.00
67_K	141_D	1.246	1.00
32_K	35_D	1.228	1.00
57_V	157_F	1.222	1.00
12_I	98_V	1.222	1.00
114_P	135_N	1.218	1.00
121_Q	154_I	1.183	1.00
117_A	145_V	1.146	1.00
65_T	68_E	1.139	1.00
83_V	152_W	1.130	1.00
84_A	98_V	1.117	1.00
29_E	32_K	1.090	1.00
51_F	126_S	1.083	1.00
121_Q	153_P	1.078	1.00
62_Y	117_A	1.069	1.00
113_P	116_F	1.040	1.00
9_G	12_I	1.014	1.00
100_V	110_L	1.011	1.00
26_F	49_M	1.011	1.00
27_F	50_S	1.007	1.00
147_Y	157_F	1.003	1.00
60_L	85_L	0.997	1.00
32_K	136_E	0.995	1.00
167_P	171_K	0.988	1.00
49_M	130_Y	0.988	1.00
23_K	161_D	0.983	1.00
82_D	118_H	0.977	1.00
154_I	157_F	0.971	1.00
65_T	141_D	0.962	1.00
121_Q	157_F	0.960	1.00
64_I	141_D	0.952	1.00
87_L	145_V	0.947	1.00
15_I	35_D	0.943	1.00
35_D	38_K	0.940	1.00
60_L	150_V	0.940	1.00
81_L	97_Y	0.933	1.00
101_E	123_L	0.924	0.99
145_V	172_A	0.922	0.99
9_G	98_V	0.916	0.99
35_D	39_A	0.909	0.99
30_V	47_T	0.909	0.99
54_K	124_E	0.903	0.99
142_E	166_C	0.901	0.99
68_E	141_D	0.898	0.99
44_I	47_T	0.889	0.99
18_K	35_D	0.888	0.99
62_Y	87_L	0.886	0.99
53_F	126_S	0.886	0.99
29_E	69_Q	0.882	0.99
100_V	108_Y	0.877	0.99
37_T	41_I	0.871	0.99
122_A	126_S	0.855	0.99
29_E	46_Q	0.847	0.99
45_V	136_E	0.840	0.99
21_P	53_F	0.840	0.99
48_N	133_T	0.840	0.99
9_G	93_T	0.840	0.99
26_F	128_V	0.838	0.99
26_F	107_H	0.831	0.99
11_G	93_T	0.828	0.99
146_N	166_C	0.827	0.99
7_N	12_I	0.814	0.99
15_I	39_A	0.813	0.99
84_A	116_F	0.802	0.99
76_P	128_V	0.796	0.98
158_I	161_D	0.793	0.98
41_I	111_W	0.789	0.98
130_Y	133_T	0.779	0.98
49_M	76_P	0.777	0.98
44_I	134_H	0.776	0.98
10_M	92_P	0.774	0.98
102_L	110_L	0.763	0.98
14_L	110_L	0.762	0.98
83_V	150_V	0.761	0.98
88_R	116_F	0.761	0.98
84_A	112_I	0.755	0.98
12_I	110_L	0.754	0.98
14_L	98_V	0.750	0.98
95_G	169_L	0.742	0.98
167_P	172_A	0.741	0.98
99_K	153_P	0.735	0.97
36_F	109_I	0.733	0.97
147_Y	159_I	0.733	0.97
64_I	172_A	0.733	0.97
111_W	134_H	0.729	0.97
10_M	93_T	0.728	0.97
143_R	167_P	0.720	0.97
84_A	110_L	0.719	0.97
123_L	153_P	0.719	0.97
6_E	11_G	0.705	0.97
9_G	84_A	0.700	0.96
14_L	106_N	0.697	0.96
41_I	114_P	0.696	0.96
79_K	127_I	0.693	0.96
75_V	80_I	0.691	0.96
21_P	107_H	0.687	0.96
73_V	129_V	0.686	0.96
144_C	167_P	0.682	0.96
15_I	72_L	0.681	0.96
71_K	82_D	0.675	0.96
107_H	128_V	0.674	0.96
29_E	48_N	0.673	0.96
30_V	49_M	0.669	0.95
162_K	166_C	0.660	0.95
93_T	96_K	0.660	0.95
104_D	128_V	0.658	0.95
19_V	28_L	0.657	0.95
27_F	48_N	0.657	0.95
7_N	98_V	0.648	0.95
36_F	41_I	0.645	0.95
74_F	130_Y	0.639	0.94
75_V	127_I	0.632	0.94
32_K	36_F	0.631	0.94
68_E	114_P	0.631	0.94
12_I	116_F	0.625	0.94
30_V	74_F	0.621	0.93
44_I	132_L	0.620	0.93
8_L	12_I	0.620	0.93
101_E	153_P	0.618	0.93
54_K	155_K	0.618	0.93
98_V	110_L	0.616	0.93
52_S	56_V	0.615	0.93
22_D	25_G	0.613	0.93
7_N	100_V	0.611	0.93
85_L	145_V	0.609	0.93
33_S	42_P	0.608	0.93
23_K	158_I	0.607	0.93
89_K	92_P	0.605	0.92
122_A	125_D	0.602	0.92
34_E	37_T	0.602	0.92
19_V	26_F	0.601	0.92
60_L	145_V	0.598	0.92
143_R	166_C	0.596	0.92
137_Y	142_E	0.596	0.92
27_F	131_F	0.594	0.92
62_Y	145_V	0.594	0.92
30_V	130_Y	0.592	0.92
28_L	107_H	0.587	0.91
53_F	158_I	0.585	0.91
81_L	123_L	0.584	0.91
54_K	156_E	0.584	0.91
45_V	135_N	0.582	0.91
89_K	95_G	0.582	0.91
168_P	172_A	0.581	0.91
143_R	172_A	0.580	0.91
97_Y	150_V	0.575	0.90
69_Q	133_T	0.572	0.90
80_I	120_F	0.571	0.90
16_K	106_N	0.570	0.90
74_F	128_V	0.569	0.90
18_K	21_P	0.568	0.90
13_V	111_W	0.567	0.90
56_V	158_I	0.564	0.90
111_W	114_P	0.564	0.90
156_E	164_S	0.562	0.89
142_E	162_K	0.561	0.89
77_K	124_E	0.558	0.89
104_D	107_H	0.556	0.89
51_F	77_K	0.556	0.89
13_V	113_P	0.547	0.88
79_K	123_L	0.545	0.88
83_V	99_K	0.544	0.88
73_V	82_D	0.544	0.88
6_E	39_A	0.544	0.88
139_K	165_Q	0.543	0.88
85_L	117_A	0.541	0.88
7_N	110_L	0.541	0.88
64_I	67_K	0.539	0.87
30_V	132_L	0.534	0.87
133_T	162_K	0.532	0.87
89_K	172_A	0.530	0.86
15_I	36_F	0.528	0.86
135_N	141_D	0.528	0.86
57_V	152_W	0.528	0.86
52_S	58_R	0.528	0.86
44_I	72_L	0.525	0.86
104_D	124_E	0.524	0.86
101_E	106_N	0.521	0.86
98_V	101_E	0.519	0.85
31_F	56_V	0.518	0.85
53_F	56_V	0.515	0.85
65_T	172_A	0.510	0.84
9_G	110_L	0.510	0.84
81_L	151_D	0.509	0.84
72_L	111_W	0.509	0.84
72_L	109_I	0.509	0.84
13_V	39_A	0.508	0.84
11_G	116_F	0.508	0.84
146_N	164_S	0.508	0.84
44_I	109_I	0.507	0.84
33_S	136_E	0.506	0.84
159_I	164_S	0.503	0.84
140_S	143_R	0.500	0.83
80_I	122_A	0.500	0.83

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3rykA	2	0.9602	100	0.19	Contact Map
1upiA	2	0.9886	100	0.19	Contact Map
1wltA	2	0.9886	100	0.19	Contact Map
2c0zA	2	1	100	0.192	Contact Map
1oi6A	2	0.9943	100	0.193	Contact Map
2ixkA	2	0.9943	100	0.194	Contact Map
4hn1A	3	0.983	100	0.195	Contact Map
1ep0A	2	0.9886	100	0.201	Contact Map
1dzrA	2	1	100	0.201	Contact Map
5buvA	2	0.9602	100	0.231	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0072 seconds.