Q97X25 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97X25 - First ORF in partial transposon ISC1913

UniProt:	Q97X25	Sequences: MERLLRPKEACQLLGISYSTLLRWIREGKIRVVTTEGGKYRIPYSEIKKYLERREEPRAVIYARVSSADQKEDLERQINYLTNYATAKGYKVVEVLKDIASGLNTQRKGLLKLFKLVEGSFRYKNFSLKIEHNSHYLRNETCFTH	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	145 (135)
Sequences:	497 (362)
Seq/√Len:	31.2

SULSO - Q97X25 Q97X40 Q97XI0 Q97YH2 Q97XB5 Q97YI6 Q97U67 Q97YU0 Q97YX0 Q97U52 Q97UQ9 Q97XQ1 Q97XZ4 Q97WZ6 Q97Y49 Q97Z60 Q7LXE3

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
59_A	127_S	4.151	1.00
63_A	81_L	3.896	1.00
98_D	109_G	3.007	1.00
85_A	129_K	2.959	1.00
10_A	14_L	2.784	1.00
105_T	142_C	2.481	0.99
16_I	24_W	2.352	0.99
20_T	24_W	2.290	0.99
5_L	10_A	2.286	0.99
110_L	136_Y	2.282	0.99
61_I	81_L	2.278	0.99
137_L	141_T	2.270	0.99
80_Y	131_E	2.147	0.98
8_K	12_Q	2.054	0.98
113_L	125_N	2.049	0.98
19_S	22_L	2.016	0.98
25_I	40_Y	1.910	0.97
103_L	139_N	1.895	0.96
21_L	42_I	1.859	0.96
78_I	97_K	1.781	0.95
94_E	116_L	1.682	0.93
84_Y	88_K	1.666	0.93
78_I	95_V	1.644	0.92
96_L	109_G	1.641	0.92
6_R	37_G	1.574	0.90
73_D	76_R	1.565	0.90
70_Q	73_D	1.520	0.89
129_K	142_C	1.495	0.88
116_L	124_K	1.450	0.86
7_P	22_L	1.429	0.85
117_V	125_N	1.426	0.85
61_I	95_V	1.405	0.84
19_S	27_E	1.354	0.82
84_Y	89_G	1.345	0.82
10_A	47_I	1.335	0.81
61_I	85_A	1.334	0.81
34_T	40_Y	1.327	0.81
117_V	130_I	1.307	0.80
58_R	116_L	1.281	0.78
117_V	128_L	1.271	0.78
66_S	70_Q	1.267	0.78
25_I	32_V	1.261	0.77
29_K	36_E	1.254	0.77
25_I	30_I	1.239	0.76
59_A	129_K	1.185	0.73
31_R	46_E	1.185	0.73
43_P	46_E	1.178	0.72
96_L	113_L	1.144	0.70
105_T	137_L	1.120	0.68
90_Y	127_S	1.115	0.68
79_N	83_N	1.111	0.68
105_T	128_L	1.110	0.68
5_L	41_R	1.101	0.67
18_Y	22_L	1.096	0.67
6_R	41_R	1.092	0.66
20_T	23_R	1.069	0.65
14_L	21_L	1.058	0.64
90_Y	93_V	1.043	0.63
23_R	26_R	1.037	0.62
67_S	76_R	1.036	0.62
33_V	41_R	1.035	0.62
70_Q	76_R	1.035	0.62
46_E	49_K	1.009	0.60
61_I	92_V	1.004	0.60
98_D	131_E	1.004	0.60
25_I	42_I	0.996	0.59
17_S	23_R	0.996	0.59
134_S	138_R	0.985	0.58
29_K	37_G	0.981	0.58
22_L	42_I	0.971	0.57
65_V	70_Q	0.962	0.56
10_A	30_I	0.946	0.55
65_V	74_L	0.940	0.55
75_E	79_N	0.936	0.54
80_Y	98_D	0.934	0.54
6_R	9_E	0.931	0.54
42_I	47_I	0.930	0.54
73_D	131_E	0.929	0.54
98_D	105_T	0.927	0.54
96_L	128_L	0.915	0.53
30_I	33_V	0.912	0.52
45_S	76_R	0.906	0.52
103_L	140_E	0.904	0.52
60_V	125_N	0.899	0.51
102_G	136_Y	0.895	0.51
75_E	78_I	0.891	0.51
5_L	44_Y	0.876	0.50
87_A	129_K	0.875	0.49
110_L	137_L	0.874	0.49
16_I	23_R	0.872	0.49
42_I	46_E	0.863	0.48
11_C	21_L	0.853	0.48
39_K	42_I	0.834	0.46
7_P	32_V	0.825	0.45
22_L	39_K	0.823	0.45
12_Q	71_K	0.822	0.45
22_L	25_I	0.816	0.45
38_G	97_K	0.807	0.44
79_N	82_T	0.804	0.44
7_P	21_L	0.803	0.44
30_I	46_E	0.795	0.43
107_R	137_L	0.791	0.43
114_F	124_K	0.790	0.43
67_S	70_Q	0.787	0.42
84_Y	127_S	0.785	0.42
25_I	34_T	0.783	0.42
29_K	115_K	0.782	0.42
11_C	18_Y	0.781	0.42
99_I	107_R	0.780	0.42
16_I	19_S	0.776	0.41
88_K	129_K	0.774	0.41
93_V	110_L	0.770	0.41
10_A	21_L	0.769	0.41
82_T	95_V	0.766	0.41
85_A	92_V	0.765	0.41
85_A	131_E	0.763	0.40
99_I	108_K	0.752	0.40
5_L	16_I	0.741	0.39
5_L	13_L	0.737	0.38
5_L	14_L	0.734	0.38
19_S	23_R	0.732	0.38
11_C	16_I	0.732	0.38
5_L	51_L	0.729	0.38
90_Y	110_L	0.722	0.37
63_A	97_K	0.716	0.37
7_P	11_C	0.712	0.37
76_R	79_N	0.710	0.36
26_R	108_K	0.709	0.36
101_S	105_T	0.696	0.35
48_K	95_V	0.691	0.35
22_L	34_T	0.690	0.35
133_N	142_C	0.681	0.34
135_H	138_R	0.681	0.34
67_S	108_K	0.678	0.34
33_V	43_P	0.676	0.34
37_G	123_Y	0.676	0.34
22_L	40_Y	0.669	0.33
63_A	101_S	0.664	0.33
32_V	42_I	0.655	0.32
7_P	18_Y	0.655	0.32
41_R	84_Y	0.652	0.32
40_Y	47_I	0.646	0.32
132_H	141_T	0.639	0.31
16_I	114_F	0.638	0.31
59_A	100_A	0.635	0.31
78_I	114_F	0.634	0.31
66_S	101_S	0.633	0.31
17_S	22_L	0.632	0.31
17_S	25_I	0.630	0.31
35_T	44_Y	0.630	0.31
11_C	15_G	0.627	0.30
60_V	78_I	0.625	0.30
8_K	37_G	0.625	0.30
68_A	71_K	0.623	0.30
45_S	48_K	0.619	0.30
31_R	50_Y	0.612	0.29
32_V	73_D	0.611	0.29
5_L	141_T	0.609	0.29
58_R	98_D	0.606	0.29
53_R	124_K	0.606	0.29
89_G	112_K	0.605	0.29
69_D	131_E	0.599	0.29
18_Y	40_Y	0.598	0.28
8_K	28_G	0.593	0.28
47_I	51_L	0.593	0.28
14_L	98_D	0.593	0.28
82_T	86_T	0.591	0.28
69_D	76_R	0.589	0.28
109_G	130_I	0.588	0.28
88_K	111_L	0.587	0.28
114_F	118_E	0.587	0.28
83_N	112_K	0.580	0.27
104_N	113_L	0.578	0.27
10_A	41_R	0.577	0.27
28_G	140_E	0.576	0.27
13_L	97_K	0.572	0.27
7_P	24_W	0.564	0.26
60_V	89_G	0.558	0.26
67_S	100_A	0.557	0.26
135_H	140_E	0.554	0.26
33_V	46_E	0.551	0.26
96_L	116_L	0.550	0.25
58_R	126_F	0.546	0.25
110_L	117_V	0.546	0.25
93_V	107_R	0.538	0.25
59_A	94_E	0.538	0.25
16_I	21_L	0.537	0.25
54_R	75_E	0.537	0.25
15_G	139_N	0.535	0.25
86_T	113_L	0.528	0.24
6_R	39_K	0.527	0.24
128_L	137_L	0.522	0.24
41_R	133_N	0.520	0.24
12_Q	79_N	0.516	0.23
98_D	101_S	0.508	0.23
128_L	136_Y	0.505	0.23
11_C	48_K	0.504	0.23
43_P	93_V	0.503	0.23
21_L	25_I	0.503	0.23
24_W	41_R	0.501	0.23
102_G	110_L	0.501	0.23
104_N	138_R	0.500	0.22

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3lhkA	2	0.5931	99.8	0.644	Contact Map
3ilxA	2	0.5586	99.8	0.664	Contact Map
2mhcA	1	0.6276	99.8	0.669	Contact Map
3bvpA	4	0.5931	99.8	0.671	Contact Map
3guvA	2	0.6	99.8	0.672	Contact Map
3g13A	2	0.6207	99.7	0.677	Contact Map
4bqqA	2	0.5793	99.7	0.688	Contact Map
2gm5A	4	0.5103	99.6	0.711	Contact Map
3whpA	1	0.4897	99.6	0.713	Contact Map
1gdtA	2	0.5379	99.6	0.717	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0061 seconds.