Q97X11 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97X11 - Uncharacterized protein

UniProt:	Q97X11	Sequences: MTFSIVIYDPEEKAWGVGVASKFLAVGAFVPWLRPNVGAIATQALANLTYGVNGLSLLEKGYSASDTIRVLTESDPLREKRQVGIVDTKGSAAAFTGKECYSYAGHIVGNNFTVQGNILAGEEVLERVSQAQIIE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	135 (132)
Sequences:	782 (564)
Seq/√Len:	49.1

HALSA - Q9HPY0
SULSO - Q97X11 Q97YH1

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
94_A	106_H	3.465	1.00
112_F	129_S	3.374	1.00
34_R	59_E	3.249	1.00
87_D	91_S	3.024	1.00
5_I	18_G	2.916	1.00
58_L	85_I	2.838	1.00
54_G	71_L	2.784	1.00
116_G	119_L	2.605	1.00
96_T	104_A	2.431	1.00
84_G	115_Q	2.422	1.00
65_S	69_R	2.319	1.00
34_R	56_S	2.251	1.00
17_V	31_P	2.233	1.00
92_A	108_V	2.085	1.00
79_E	98_K	2.011	1.00
39_A	86_V	1.954	0.99
109_G	112_F	1.943	0.99
47_N	75_D	1.910	0.99
107_I	126_E	1.896	0.99
84_G	113_T	1.840	0.99
29_F	46_A	1.743	0.99
126_E	130_Q	1.731	0.99
120_A	124_V	1.702	0.98
107_I	125_L	1.640	0.98
94_A	108_V	1.638	0.98
68_I	72_T	1.628	0.98
63_S	66_D	1.624	0.98
64_A	91_S	1.573	0.97
27_G	31_P	1.571	0.97
44_A	100_C	1.536	0.97
23_F	46_A	1.527	0.97
68_I	85_I	1.513	0.97
114_V	129_S	1.486	0.96
101_Y	118_I	1.467	0.96
19_V	30_V	1.443	0.95
54_G	67_T	1.364	0.94
64_A	87_D	1.362	0.94
62_Y	70_V	1.357	0.94
103_Y	121_G	1.312	0.93
40_I	54_G	1.294	0.92
5_I	128_V	1.285	0.92
72_T	83_V	1.279	0.92
56_S	60_K	1.250	0.91
105_G	125_L	1.236	0.90
24_L	32_W	1.230	0.90
53_N	74_S	1.222	0.90
70_V	73_E	1.216	0.89
57_L	62_Y	1.210	0.89
57_L	71_L	1.181	0.88
32_W	51_G	1.177	0.88
8_Y	111_N	1.174	0.88
29_F	48_L	1.165	0.87
128_V	131_A	1.159	0.87
84_G	94_A	1.130	0.85
67_T	71_L	1.111	0.85
8_Y	15_W	1.093	0.84
3_F	128_V	1.072	0.82
49_T	52_V	1.064	0.82
17_V	41_A	1.025	0.79
53_N	56_S	1.024	0.79
127_R	130_Q	1.024	0.79
9_D	14_A	1.023	0.79
87_D	92_A	1.015	0.79
50_Y	72_T	1.014	0.79
30_V	41_A	0.992	0.77
54_G	57_L	0.981	0.76
10_P	111_N	0.979	0.76
72_T	78_R	0.977	0.76
6_V	86_V	0.971	0.76
36_N	88_T	0.962	0.75
33_L	41_A	0.961	0.75
66_D	70_V	0.960	0.75
94_A	113_T	0.949	0.74
7_I	132_Q	0.947	0.74
42_T	52_V	0.941	0.73
54_G	85_I	0.928	0.72
40_I	51_G	0.927	0.72
66_D	69_R	0.917	0.71
34_R	37_V	0.911	0.71
22_K	44_A	0.893	0.69
57_L	70_V	0.863	0.67
114_V	128_V	0.850	0.65
33_L	39_A	0.838	0.64
22_K	46_A	0.831	0.64
63_S	91_S	0.826	0.63
3_F	20_A	0.814	0.62
37_V	59_E	0.814	0.62
17_V	39_A	0.808	0.61
15_W	39_A	0.801	0.61
79_E	99_E	0.800	0.61
96_T	100_C	0.794	0.60
107_I	129_S	0.794	0.60
64_A	67_T	0.793	0.60
107_I	112_F	0.790	0.60
58_L	67_T	0.784	0.59
8_Y	12_E	0.782	0.59
72_T	75_D	0.778	0.59
9_D	132_Q	0.773	0.58
100_C	104_A	0.766	0.57
46_A	115_Q	0.765	0.57
70_V	74_S	0.761	0.57
10_P	110_N	0.759	0.57
122_E	126_E	0.751	0.56
37_V	55_L	0.736	0.54
67_T	85_I	0.735	0.54
116_G	125_L	0.724	0.53
32_W	42_T	0.719	0.53
40_I	67_T	0.718	0.52
6_V	84_G	0.714	0.52
24_L	46_A	0.714	0.52
68_I	83_V	0.710	0.52
45_L	101_Y	0.698	0.50
129_S	132_Q	0.690	0.50
6_V	39_A	0.689	0.50
47_N	54_G	0.688	0.49
105_G	122_E	0.685	0.49
45_L	100_C	0.684	0.49
9_D	12_E	0.677	0.48
47_N	71_L	0.676	0.48
20_A	30_V	0.670	0.48
45_L	102_S	0.665	0.47
57_L	60_K	0.665	0.47
24_L	101_Y	0.662	0.47
104_A	115_Q	0.660	0.47
64_A	93_A	0.657	0.46
22_K	29_F	0.654	0.46
45_L	80_K	0.654	0.46
21_S	28_A	0.650	0.46
44_A	101_Y	0.647	0.45
68_I	93_A	0.645	0.45
103_Y	120_A	0.644	0.45
5_I	114_V	0.640	0.45
69_R	72_T	0.637	0.44
44_A	103_Y	0.636	0.44
19_V	26_V	0.634	0.44
29_F	44_A	0.631	0.44
7_I	42_T	0.621	0.43
3_F	24_L	0.619	0.42
62_Y	66_D	0.619	0.42
63_S	76_P	0.617	0.42
107_I	114_V	0.616	0.42
7_I	122_E	0.614	0.42
72_T	76_P	0.613	0.42
75_D	81_R	0.612	0.42
84_G	104_A	0.611	0.42
38_G	55_L	0.603	0.41
69_R	89_K	0.600	0.41
3_F	125_L	0.599	0.41
9_D	50_Y	0.599	0.41
74_S	78_R	0.597	0.40
78_R	95_F	0.597	0.40
80_K	101_Y	0.594	0.40
60_K	98_K	0.593	0.40
23_F	29_F	0.593	0.40
80_K	99_E	0.589	0.40
30_V	50_Y	0.589	0.40
89_K	111_N	0.589	0.40
92_A	113_T	0.581	0.39
110_N	130_Q	0.571	0.38
49_T	53_N	0.568	0.38
6_V	41_A	0.567	0.37
33_L	113_T	0.562	0.37
21_S	44_A	0.562	0.37
69_R	73_E	0.559	0.37
71_L	78_R	0.559	0.37
84_G	100_C	0.557	0.36
20_A	128_V	0.556	0.36
23_F	28_A	0.555	0.36
103_Y	125_L	0.551	0.36
20_A	25_A	0.551	0.36
15_W	64_A	0.550	0.36
54_G	58_L	0.550	0.36
24_L	45_L	0.549	0.36
96_T	103_Y	0.547	0.36
23_F	50_Y	0.542	0.35
28_A	48_L	0.539	0.35
21_S	49_T	0.538	0.35
42_T	100_C	0.537	0.35
106_H	113_T	0.535	0.34
34_R	55_L	0.533	0.34
41_A	115_Q	0.532	0.34
44_A	80_K	0.530	0.34
65_S	73_E	0.526	0.34
127_R	131_A	0.525	0.34
89_K	130_Q	0.524	0.33
3_F	115_Q	0.524	0.33
68_I	127_R	0.523	0.33
15_W	24_L	0.522	0.33
64_A	85_I	0.520	0.33
24_L	31_P	0.518	0.33
22_K	101_Y	0.517	0.33
31_P	42_T	0.516	0.33
21_S	27_G	0.511	0.32
40_I	83_V	0.510	0.32
67_T	72_T	0.508	0.32
58_L	78_R	0.507	0.32
73_E	89_K	0.503	0.32
21_S	29_F	0.500	0.31

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2imhA	2	0.9926	100	0.057	Contact Map
4pv2B	2	0.763	86.1	0.906	Contact Map
2gezB	2	0.763	81	0.911	Contact Map
1k2xB	2	0.837	78.5	0.914	Contact Map
1p4kA	2	0.8741	75.8	0.916	Contact Map
1apyB	2	0.8741	64.3	0.922	Contact Map
4o0cA	2	0.9111	59.2	0.925	Contact Map
3c17A	2	0.8593	57.7	0.925	Contact Map
3wu2O	1	0.3481	21.1	0.942	Contact Map
4pj0O	1	0.3481	20.7	0.942	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0058 seconds.