Q97X10 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97X10 - Uncharacterized protein

UniProt:	Q97X10	Sequences: MHLGHSLEAMAKEAESKGKIYEKILRALKAGESKGGDRRGKQSAAIIVVKTVDKSEKEIDPLIVGKYVDLRVDDSQDPLKDLERLLDLWVATFIEEEMVNVKDYENQIRQALNKWGYNDLRTWVEMNNLEGKYTGDKIGKTVLKILLSKE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	150 (138)
Sequences:	207 (158)
Seq/√Len:	13.4

HALSA - Q9HPY0
SULSO - Q97X10 Q97YH1

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
41_K	77_D	3.738	0.99
32_E	41_K	3.489	0.99
29_K	83_E	3.399	0.99
107_Q	147_L	2.969	0.97
6_S	90_V	2.941	0.97
11_A	15_E	2.859	0.96
32_E	79_L	2.755	0.95
81_D	84_R	2.648	0.94
31_G	108_I	2.610	0.93
22_E	90_V	2.562	0.93
125_E	130_E	2.345	0.89
32_E	77_D	2.164	0.84
7_L	21_Y	2.019	0.80
75_S	81_D	1.998	0.79
79_L	126_M	1.901	0.75
10_M	31_G	1.772	0.70
75_S	84_R	1.753	0.69
10_M	30_A	1.722	0.68
132_K	139_G	1.716	0.67
70_L	85_L	1.711	0.67
117_Y	126_M	1.663	0.65
111_A	147_L	1.651	0.64
100_N	141_T	1.646	0.64
124_V	133_Y	1.646	0.64
9_A	12_K	1.640	0.64
51_T	108_I	1.593	0.61
55_S	91_A	1.577	0.60
102_K	108_I	1.576	0.60
50_K	53_D	1.548	0.59
33_S	144_K	1.525	0.58
24_I	128_N	1.510	0.57
70_L	73_D	1.484	0.56
77_D	80_K	1.462	0.54
141_T	145_I	1.447	0.54
123_W	145_I	1.413	0.52
88_L	92_T	1.401	0.51
102_K	106_N	1.388	0.51
140_K	144_K	1.324	0.47
105_E	108_I	1.309	0.46
95_E	131_G	1.290	0.45
129_L	146_L	1.277	0.45
14_A	34_K	1.233	0.42
123_W	146_L	1.227	0.42
58_E	65_G	1.226	0.42
25_L	31_G	1.211	0.41
67_Y	109_R	1.205	0.41
53_D	66_K	1.181	0.40
27_A	76_Q	1.173	0.39
14_A	20_I	1.149	0.38
50_K	67_Y	1.138	0.38
93_F	120_L	1.108	0.36
38_R	135_G	1.107	0.36
129_L	145_I	1.095	0.35
45_A	120_L	1.084	0.35
116_G	128_N	1.082	0.35
76_Q	109_R	1.072	0.34
137_K	145_I	1.046	0.33
34_K	55_S	1.044	0.33
115_W	124_V	1.038	0.33
11_A	25_L	1.030	0.32
26_R	29_K	1.019	0.32
20_I	135_G	1.007	0.31
55_S	132_K	1.004	0.31
127_N	132_K	1.001	0.31
110_Q	118_N	0.988	0.30
108_I	120_L	0.987	0.30
106_N	138_I	0.985	0.30
18_G	48_V	0.982	0.30
70_L	92_T	0.979	0.30
143_L	147_L	0.975	0.30
97_E	101_V	0.964	0.29
107_Q	143_L	0.952	0.29
122_T	126_M	0.950	0.29
41_K	50_K	0.929	0.28
31_G	96_E	0.916	0.27
87_D	118_N	0.911	0.27
79_L	123_W	0.906	0.27
73_D	129_L	0.905	0.27
98_M	101_V	0.898	0.27
119_D	122_T	0.895	0.26
96_E	134_T	0.893	0.26
47_I	102_K	0.886	0.26
75_S	79_L	0.879	0.26
75_S	119_D	0.879	0.26
22_E	87_D	0.879	0.26
7_L	65_G	0.878	0.26
52_V	80_K	0.876	0.26
53_D	104_Y	0.873	0.25
65_G	78_P	0.868	0.25
93_F	130_E	0.867	0.25
26_R	30_A	0.864	0.25
127_N	139_G	0.863	0.25
30_A	122_T	0.857	0.25
13_E	30_A	0.853	0.25
25_L	126_M	0.846	0.24
125_E	133_Y	0.846	0.24
18_G	53_D	0.844	0.24
20_I	45_A	0.842	0.24
54_K	65_G	0.838	0.24
104_Y	147_L	0.837	0.24
51_T	79_L	0.825	0.24
116_G	130_E	0.820	0.23
91_A	132_K	0.818	0.23
6_S	32_E	0.817	0.23
13_E	114_K	0.816	0.23
10_M	13_E	0.813	0.23
29_K	79_L	0.807	0.23
56_E	102_K	0.797	0.23
66_K	123_W	0.782	0.22
5_H	8_E	0.779	0.22
98_M	102_K	0.778	0.22
19_K	94_I	0.777	0.22
96_E	139_G	0.775	0.22
68_V	113_N	0.773	0.22
55_S	58_E	0.768	0.21
92_T	127_N	0.764	0.21
139_G	143_L	0.761	0.21
112_L	129_L	0.759	0.21
34_K	139_G	0.753	0.21
63_I	68_V	0.751	0.21
7_L	45_A	0.750	0.21
110_Q	113_N	0.750	0.21
98_M	142_V	0.747	0.21
7_L	92_T	0.745	0.21
43_S	70_L	0.736	0.20
30_A	76_Q	0.736	0.20
80_K	113_N	0.732	0.20
18_G	22_E	0.718	0.20
69_D	108_I	0.716	0.20
56_E	127_N	0.713	0.20
24_I	55_S	0.711	0.20
71_R	130_E	0.710	0.19
41_K	73_D	0.702	0.19
45_A	126_M	0.699	0.19
9_A	106_N	0.698	0.19
91_A	131_G	0.697	0.19
21_Y	68_V	0.692	0.19
96_E	100_N	0.691	0.19
118_N	125_E	0.686	0.19
54_K	75_S	0.686	0.19
6_S	86_L	0.669	0.18
15_E	77_D	0.667	0.18
79_L	87_D	0.666	0.18
18_G	50_K	0.666	0.18
111_A	146_L	0.655	0.18
8_E	12_K	0.655	0.18
58_E	127_N	0.652	0.18
38_R	141_T	0.640	0.17
118_N	122_T	0.639	0.17
50_K	117_Y	0.637	0.17
6_S	64_V	0.635	0.17
114_K	122_T	0.633	0.17
113_N	144_K	0.633	0.17
29_K	32_E	0.632	0.17
19_K	22_E	0.628	0.17
105_E	136_D	0.623	0.17
137_K	141_T	0.621	0.17
46_I	86_L	0.621	0.17
56_E	131_G	0.621	0.17
94_I	121_R	0.620	0.17
100_N	114_K	0.616	0.17
94_I	143_L	0.615	0.16
55_S	65_G	0.610	0.16
20_I	115_W	0.600	0.16
24_I	112_L	0.597	0.16
89_W	127_N	0.593	0.16
6_S	14_A	0.590	0.16
114_K	118_N	0.586	0.16
100_N	136_D	0.585	0.16
126_M	133_Y	0.578	0.15
26_R	107_Q	0.578	0.15
141_T	146_L	0.577	0.15
14_A	18_G	0.575	0.15
108_I	124_V	0.574	0.15
12_K	15_E	0.569	0.15
130_E	133_Y	0.568	0.15
34_K	127_N	0.567	0.15
9_A	19_K	0.557	0.15
69_D	72_V	0.556	0.15
99_V	134_T	0.553	0.15
8_E	11_A	0.552	0.15
18_G	25_L	0.550	0.15
100_N	145_I	0.545	0.15
14_A	90_V	0.545	0.15
56_E	132_K	0.542	0.14
7_L	54_K	0.541	0.14
24_I	58_E	0.536	0.14
21_Y	46_I	0.534	0.14
51_T	94_I	0.533	0.14
17_K	138_I	0.529	0.14
86_L	133_Y	0.529	0.14
25_L	46_I	0.529	0.14
6_S	123_W	0.528	0.14
22_E	109_R	0.528	0.14
10_M	20_I	0.528	0.14
54_K	91_A	0.528	0.14
106_N	109_R	0.524	0.14
77_D	137_K	0.519	0.14
6_S	15_E	0.518	0.14
10_M	137_K	0.518	0.14
34_K	58_E	0.516	0.14
24_I	34_K	0.508	0.14
12_K	29_K	0.503	0.13
58_E	128_N	0.502	0.13
25_L	86_L	0.502	0.13
63_I	119_D	0.501	0.13
8_E	15_E	0.500	0.13

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2imhA	2	0.6533	100	0.568	Contact Map
1vjzA	1	0.4467	22.7	0.95	Contact Map
3ix3A	2	0.3933	10	0.957	Contact Map
4fetB	1	0	9.8	0.958	Contact Map
2d1zA	1	0.4667	8.2	0.959	Contact Map
2jugA	2	0.3267	7.2	0.96	Contact Map
3aofA	1	0.5133	6.1	0.961	Contact Map
3aeyA	2	0.5467	5.8	0.962	Contact Map
4cgrA	2	0.5533	5.6	0.962	Contact Map
3bkhA	1	0.5133	5.5	0.962	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0057 seconds.