Q97X05 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97X05 - Dolichyl-phosphate mannose synthase related protein

UniProt:	Q97X05	Sequences: MISIIIPAFNEERRIGRTLEKISSTLPNAEIVVVFDGHDNTPEVVKKFPVKLLISESRLGKGGAIKRGINESNFQRVLLLDADFPITEEELDKILSTDADLVIPKRKIVGMPLKRKFLHKGFIIITKILFPSLAKFSDFQAGVKLVNREKVLDILDELIINDFLFDVNLIYGFKRRHYKVKEVEINYIHDESDSKISKKLIKVIILMFLSLIKLRVYYSPFRKILYTKTYLKAQDYILRKLR	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	242 (206)
Sequences:	44939 (37719)
Seq/√Len:	2628.0

ECOLI - ARNC YIBD WBBL WCAE WCAA GTRB PGAC YAIP
BACSU - CGED GGAA EPSJ EPSH EPSE GGAB CSBB SPSA YKCC YWDF TUAG YKOT YFNE YDAM TAGF
HALSA - Q9HQP8 Q9HNK3 Q9HQP4 Q9HSC8 Q9HR08 Q9HQQ6 Q9HQP3 Q9HSB1
SULSO - Q97X05 Q97YG5 Q7LXG6 Q7LXF7 Q97TZ0 Q97TY0 Q97W52 Q97YM4 Q97UK7 Q97WK7 Q7LXY2 Q97YN4

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
148_R	152_L	3.472	1.00
11_E	82_A	3.274	1.00
12_E	40_N	2.974	1.00
168_N	172_G	2.557	1.00
93_K	185_I	2.493	1.00
8_A	41_T	2.419	1.00
67_R	71_E	2.372	1.00
35_F	54_I	2.300	1.00
3_S	74_F	2.233	1.00
42_P	46_K	2.224	1.00
30_E	51_K	2.109	1.00
34_V	68_G	2.097	1.00
16_G	20_E	2.084	1.00
5_I	68_G	2.026	1.00
99_A	181_K	1.999	1.00
40_N	43_E	1.977	1.00
6_I	31_I	1.965	1.00
65_I	81_D	1.953	1.00
150_K	178_Y	1.930	1.00
3_S	30_E	1.894	1.00
55_S	67_R	1.869	1.00
59_L	63_G	1.845	1.00
17_R	85_P	1.830	1.00
16_G	48_F	1.825	1.00
35_F	38_H	1.808	1.00
53_L	71_E	1.807	1.00
94_I	145_L	1.807	1.00
78_L	145_L	1.800	1.00
97_T	183_V	1.789	1.00
97_T	181_K	1.744	1.00
76_R	145_L	1.744	1.00
20_E	48_F	1.732	1.00
42_P	54_I	1.722	1.00
12_E	44_V	1.720	1.00
90_E	94_I	1.680	1.00
51_K	71_E	1.679	1.00
42_P	52_L	1.677	1.00
87_T	188_I	1.670	1.00
16_G	44_V	1.646	1.00
86_I	90_E	1.638	1.00
33_V	45_V	1.622	1.00
6_I	18_T	1.610	1.00
16_G	47_K	1.600	1.00
9_F	58_R	1.593	1.00
61_K	65_I	1.590	1.00
67_R	70_N	1.567	1.00
26_L	95_L	1.556	1.00
100_D	147_N	1.548	1.00
8_A	33_V	1.504	1.00
89_E	93_K	1.497	1.00
46_K	54_I	1.492	1.00
20_E	24_S	1.488	1.00
53_L	67_R	1.473	1.00
8_A	11_E	1.461	1.00
30_E	74_F	1.457	1.00
62_G	165_F	1.441	1.00
192_S	195_K	1.436	1.00
78_L	91_L	1.414	1.00
17_R	190_D	1.397	1.00
69_I	151_V	1.394	1.00
92_D	96_S	1.390	1.00
26_L	29_A	1.382	1.00
36_D	58_R	1.368	1.00
93_K	96_S	1.363	1.00
65_I	79_L	1.356	1.00
149_E	153_D	1.353	1.00
70_N	156_D	1.348	1.00
10_N	38_H	1.343	1.00
78_L	90_E	1.338	1.00
80_L	86_I	1.328	1.00
153_D	176_R	1.308	1.00
56_E	59_L	1.306	1.00
77_V	148_R	1.299	1.00
44_V	48_F	1.285	1.00
35_F	55_S	1.274	1.00
11_E	14_R	1.269	1.00
153_D	178_Y	1.236	1.00
158_L	161_N	1.229	1.00
2_I	95_L	1.221	1.00
144_K	170_I	1.221	1.00
100_D	178_Y	1.219	1.00
8_A	82_A	1.216	1.00
72_S	148_R	1.210	1.00
3_S	72_S	1.192	1.00
75_Q	147_N	1.178	1.00
150_K	173_F	1.174	1.00
19_L	31_I	1.169	1.00
44_V	47_K	1.161	1.00
45_V	52_L	1.157	1.00
35_F	42_P	1.156	1.00
34_V	64_A	1.150	1.00
30_E	73_N	1.145	1.00
56_E	67_R	1.142	1.00
2_I	91_L	1.142	1.00
101_L	180_V	1.140	1.00
19_L	48_F	1.137	1.00
149_E	152_L	1.135	1.00
69_I	79_L	1.124	1.00
61_K	165_F	1.104	1.00
21_K	86_I	1.081	1.00
147_N	150_K	1.072	1.00
94_I	104_P	1.072	1.00
63_G	159_I	1.059	1.00
107_K	188_I	1.052	1.00
70_N	157_E	1.052	1.00
43_E	46_K	1.042	1.00
55_S	64_A	1.040	1.00
18_T	80_L	1.030	1.00
40_N	44_V	1.015	1.00
3_S	32_V	1.008	1.00
23_S	49_P	1.004	1.00
7_P	64_A	1.003	1.00
85_P	188_I	1.003	1.00
78_L	86_I	0.991	1.00
24_S	88_E	0.990	1.00
89_E	92_D	0.988	1.00
55_S	59_L	0.986	1.00
100_D	179_K	0.979	1.00
31_I	50_V	0.978	1.00
69_I	77_V	0.975	1.00
99_A	103_I	0.965	1.00
23_S	48_F	0.955	1.00
93_K	183_V	0.949	1.00
43_E	47_K	0.946	1.00
36_D	64_A	0.936	1.00
51_K	73_N	0.932	1.00
20_E	23_S	0.931	1.00
63_G	67_R	0.930	1.00
151_V	169_L	0.928	1.00
101_L	173_F	0.926	1.00
22_I	80_L	0.920	1.00
65_I	165_F	0.920	1.00
114_K	117_F	0.919	1.00
99_A	106_R	0.917	1.00
22_I	31_I	0.904	1.00
56_E	63_G	0.895	1.00
99_A	104_P	0.891	1.00
105_K	182_E	0.889	1.00
206_L	210_S	0.875	1.00
155_L	158_L	0.867	1.00
21_K	85_P	0.861	1.00
106_R	142_G	0.859	1.00
192_S	197_S	0.854	1.00
19_L	33_V	0.852	1.00
76_R	95_L	0.851	1.00
93_K	97_T	0.840	1.00
42_P	55_S	0.840	1.00
107_K	186_N	0.834	1.00
90_E	104_P	0.830	1.00
61_K	141_A	0.828	1.00
61_K	81_D	0.824	1.00
23_S	50_V	0.816	1.00
29_A	91_L	0.815	1.00
158_L	168_N	0.809	1.00
36_D	59_L	0.809	1.00
98_D	179_K	0.806	1.00
52_L	55_S	0.798	1.00
87_T	90_E	0.791	1.00
4_I	22_I	0.790	1.00
34_V	67_R	0.786	1.00
17_R	20_E	0.779	1.00
62_G	66_K	0.779	1.00
29_A	49_P	0.771	1.00
36_D	60_G	0.767	1.00
124_I	128_I	0.765	1.00
19_L	23_S	0.764	1.00
4_I	78_L	0.758	1.00
69_I	72_S	0.755	1.00
203_V	207_M	0.755	1.00
187_Y	190_D	0.752	1.00
18_T	21_K	0.751	1.00
8_A	15_I	0.750	1.00
85_P	190_D	0.748	1.00
59_L	64_A	0.744	1.00
192_S	196_I	0.739	1.00
193_D	196_I	0.738	1.00
8_A	45_V	0.738	1.00
97_T	102_V	0.738	1.00
105_K	108_I	0.735	1.00
7_P	82_A	0.732	1.00
75_Q	149_E	0.731	1.00
46_K	55_S	0.730	1.00
95_L	145_L	0.726	1.00
32_V	71_E	0.723	1.00
141_A	144_K	0.720	1.00
183_V	186_N	0.713	1.00
32_V	68_G	0.711	1.00
46_K	52_L	0.710	1.00
6_I	22_I	0.708	1.00
22_I	86_I	0.708	1.00
15_I	44_V	0.706	1.00
76_R	147_N	0.698	1.00
111_M	114_K	0.696	1.00
25_T	92_D	0.693	1.00
37_G	58_R	0.689	1.00
18_T	22_I	0.688	1.00
100_D	104_P	0.686	1.00
173_F	178_Y	0.681	1.00
154_I	173_F	0.681	1.00
64_A	67_R	0.679	1.00
105_K	184_E	0.675	1.00
150_K	154_I	0.674	1.00
26_L	92_D	0.672	1.00
7_P	65_I	0.672	1.00
12_E	16_G	0.671	1.00
115_R	118_L	0.671	1.00
200_L	203_V	0.670	1.00
146_V	151_V	0.669	1.00
66_K	70_N	0.668	1.00
204_I	207_M	0.664	1.00
154_I	176_R	0.662	1.00
90_E	143_V	0.662	1.00
103_I	106_R	0.657	1.00
94_I	102_V	0.656	1.00
204_I	208_F	0.653	1.00
142_G	187_Y	0.652	1.00
4_I	91_L	0.649	1.00
28_N	49_P	0.649	1.00
146_V	170_I	0.648	1.00
42_P	45_V	0.648	1.00
206_L	209_L	0.647	1.00
32_V	51_K	0.644	1.00
72_S	77_V	0.641	1.00
121_G	124_I	0.639	1.00
9_F	36_D	0.638	1.00
120_K	124_I	0.637	1.00
7_P	36_D	0.633	1.00
87_T	107_K	0.631	1.00
99_A	102_V	0.628	1.00
63_G	160_I	0.626	1.00
169_L	173_F	0.624	1.00
64_A	81_D	0.622	1.00
32_V	72_S	0.620	1.00
201_I	204_I	0.619	1.00
84_F	190_D	0.619	1.00
15_I	82_A	0.616	1.00
112_P	115_R	0.614	1.00
122_F	125_I	0.613	1.00
66_K	157_E	0.610	1.00
61_K	64_A	0.608	1.00
150_K	153_D	0.607	1.00
202_K	206_L	0.604	1.00
126_T	130_F	0.602	1.00
207_M	211_L	0.596	1.00
114_K	118_L	0.596	1.00
9_F	37_G	0.595	1.00
94_I	97_T	0.594	1.00
12_E	43_E	0.594	1.00
90_E	93_K	0.593	1.00
150_K	177_H	0.589	1.00
203_V	206_L	0.587	1.00
79_L	146_V	0.587	1.00
15_I	45_V	0.586	1.00
128_I	131_P	0.586	1.00
36_D	81_D	0.585	1.00
4_I	29_A	0.585	1.00
100_D	150_K	0.582	1.00
113_L	116_K	0.577	1.00
111_M	115_R	0.576	1.00
10_N	41_T	0.572	1.00
151_V	156_D	0.570	1.00
146_V	169_L	0.567	1.00
12_E	15_I	0.564	1.00
122_F	126_T	0.564	1.00
109_V	113_L	0.564	1.00
119_H	122_F	0.563	1.00
167_V	171_Y	0.562	1.00
59_L	67_R	0.560	1.00
113_L	117_F	0.559	1.00
146_V	173_F	0.557	1.00
5_I	34_V	0.557	1.00
110_G	114_K	0.556	1.00
207_M	210_S	0.555	1.00
12_E	39_D	0.553	1.00
125_I	128_I	0.553	1.00
99_A	105_K	0.547	1.00
99_A	147_N	0.547	1.00
61_K	196_I	0.545	1.00
61_K	79_L	0.543	1.00
27_P	92_D	0.543	1.00
203_V	210_S	0.541	1.00
94_I	143_V	0.540	1.00
208_F	211_L	0.539	1.00
5_I	72_S	0.538	1.00
78_L	143_V	0.538	1.00
6_I	82_A	0.535	1.00
2_I	145_L	0.535	1.00
201_I	205_I	0.533	1.00
100_D	105_K	0.529	1.00
6_I	33_V	0.529	1.00
81_D	165_F	0.528	1.00
164_L	167_V	0.524	1.00
205_I	209_L	0.522	1.00
79_L	157_E	0.520	1.00
18_T	83_D	0.519	1.00
123_I	126_T	0.511	1.00
33_V	50_V	0.510	1.00
194_S	197_S	0.510	1.00
86_I	91_L	0.510	1.00
2_I	26_L	0.509	1.00
125_I	129_L	0.509	1.00
21_K	89_E	0.508	1.00
109_V	112_P	0.508	1.00
200_L	204_I	0.507	1.00
55_S	58_R	0.507	1.00
135_K	179_K	0.506	1.00
12_E	41_T	0.505	1.00
17_R	191_E	0.503	1.00
23_S	29_A	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3l7iA	4	0	100	0.31	Contact Map
1qg8A	1	0.8595	100	0.328	Contact Map
2z86A	2	0.9711	100	0.343	Contact Map
1xhbA	1	0.9545	100	0.345	Contact Map
3bcvA	2	0.686	100	0.345	Contact Map
2d7iA	1	1	100	0.355	Contact Map
5ajoA	1	1	100	0.359	Contact Map
4fixA	3	0.9959	100	0.362	Contact Map
2bo4A	4	0.9628	100	0.401	Contact Map
4p02A	1	0.9835	100	0.409	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.008 seconds.