Q97WZ6 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97WZ6 - First ORF in transposon ISC1913

UniProt:	Q97WZ6	Sequences: MERLLRPKEACQLLSISYSTLLRWIREGKIKVVTTEGGKYRIPYSEIKKYLEKREETRAVIYARVSSADQREDLERQINYLTNYATAKGYKVVEVLKDIASGLNTQRKGLLKLFKLVEGSFRYKNLSMKNRA	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	132 (124)
Sequences:	493 (365)
Seq/√Len:	32.8

SULSO - Q97WZ6 Q97X40 Q97X25 Q97XI0 Q97YH2 Q97XB5 Q97U67 Q97UQ9 Q97YI6 Q97YU0 Q97U52 Q97YX0 Q97XQ1 Q97XZ4 Q7LXE3 Q97Y49 Q97Z60

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
63_A	81_L	4.365	1.00
59_A	125_N	4.270	1.00
10_A	14_L	2.884	1.00
85_A	127_S	2.760	1.00
98_D	109_G	2.643	1.00
8_K	12_Q	2.355	0.99
21_L	42_I	2.351	0.99
16_I	24_W	2.297	0.99
5_L	10_A	2.233	0.99
20_T	24_W	2.202	0.99
61_I	81_L	2.201	0.99
80_Y	129_K	2.071	0.98
119_G	122_R	2.034	0.98
19_S	22_L	1.938	0.97
25_I	40_Y	1.887	0.97
84_Y	88_K	1.808	0.96
78_I	97_K	1.772	0.95
116_L	122_R	1.705	0.94
78_I	95_V	1.692	0.94
96_L	109_G	1.656	0.93
113_L	123_Y	1.630	0.93
117_V	126_L	1.630	0.93
117_V	123_Y	1.584	0.92
58_R	116_L	1.565	0.91
6_R	37_G	1.558	0.91
19_S	27_E	1.546	0.91
94_E	116_L	1.505	0.90
70_Q	73_D	1.474	0.89
25_I	30_I	1.441	0.87
43_P	46_E	1.435	0.87
61_I	95_V	1.421	0.87
34_T	40_Y	1.419	0.87
7_P	22_L	1.379	0.85
117_V	128_M	1.358	0.84
66_S	70_Q	1.345	0.83
5_L	41_R	1.306	0.82
61_I	85_A	1.304	0.81
98_D	129_K	1.298	0.81
25_I	32_V	1.264	0.79
73_D	76_R	1.223	0.77
30_I	33_V	1.183	0.75
90_Y	93_V	1.175	0.74
60_V	123_Y	1.172	0.74
59_A	127_S	1.139	0.72
20_T	23_R	1.129	0.71
25_I	42_I	1.126	0.71
6_R	41_R	1.119	0.70
67_S	76_R	1.107	0.70
98_D	105_T	1.099	0.69
29_K	36_E	1.076	0.67
84_Y	89_G	1.076	0.67
90_Y	125_N	1.071	0.67
22_L	39_K	1.055	0.66
61_I	92_V	1.054	0.66
75_E	79_N	1.050	0.65
79_N	82_T	1.042	0.65
29_K	37_G	1.033	0.64
114_F	118_E	1.030	0.64
23_R	26_R	1.027	0.64
10_A	47_I	1.022	0.63
14_L	21_L	1.016	0.63
42_I	46_E	1.000	0.62
11_C	16_I	0.998	0.61
30_I	46_E	0.995	0.61
80_Y	98_D	0.989	0.61
45_S	76_R	0.963	0.59
79_N	83_N	0.955	0.58
33_V	41_R	0.942	0.57
22_L	42_I	0.941	0.57
101_S	105_T	0.938	0.57
73_D	129_K	0.906	0.54
96_L	113_L	0.899	0.53
5_L	44_Y	0.896	0.53
47_I	126_L	0.892	0.53
10_A	30_I	0.887	0.52
31_K	46_E	0.877	0.52
7_P	32_V	0.876	0.51
70_Q	76_R	0.876	0.51
18_Y	22_L	0.870	0.51
87_A	127_S	0.864	0.50
46_E	49_K	0.859	0.50
7_P	11_C	0.841	0.49
105_T	126_L	0.837	0.48
10_A	41_R	0.836	0.48
82_T	95_V	0.835	0.48
68_A	71_R	0.825	0.47
22_L	25_I	0.823	0.47
10_A	21_L	0.819	0.47
93_V	110_L	0.815	0.46
5_L	13_L	0.803	0.45
84_Y	125_N	0.802	0.45
59_A	100_A	0.800	0.45
13_L	97_K	0.795	0.45
98_D	101_S	0.792	0.44
42_I	47_I	0.788	0.44
41_R	84_Y	0.786	0.44
75_E	78_I	0.785	0.44
32_V	42_I	0.783	0.44
99_I	107_R	0.781	0.44
18_Y	40_Y	0.780	0.44
7_P	18_Y	0.773	0.43
29_K	115_K	0.771	0.43
26_R	108_K	0.770	0.43
104_N	113_L	0.766	0.42
62_Y	74_L	0.761	0.42
67_S	108_K	0.753	0.41
14_L	98_D	0.753	0.41
17_S	23_R	0.741	0.40
11_C	21_L	0.735	0.40
115_K	123_Y	0.727	0.39
33_V	46_E	0.727	0.39
39_K	42_I	0.723	0.39
53_K	122_R	0.711	0.38
100_A	104_N	0.709	0.38
93_V	127_S	0.707	0.38
65_V	70_Q	0.705	0.38
33_V	39_K	0.705	0.38
11_C	15_S	0.699	0.37
22_L	34_T	0.696	0.37
70_Q	108_K	0.692	0.37
5_L	16_I	0.690	0.36
63_A	101_S	0.688	0.36
72_E	112_K	0.685	0.36
45_S	48_K	0.680	0.36
96_L	126_L	0.678	0.35
5_L	14_L	0.676	0.35
67_S	100_A	0.675	0.35
37_G	120_S	0.674	0.35
90_Y	110_L	0.666	0.35
69_D	129_K	0.664	0.34
22_L	40_Y	0.662	0.34
59_A	94_E	0.657	0.34
16_I	114_F	0.652	0.33
7_P	21_L	0.651	0.33
12_Q	15_S	0.649	0.33
33_V	43_P	0.637	0.32
55_E	58_R	0.634	0.32
16_I	41_R	0.634	0.32
114_F	122_R	0.624	0.31
85_A	92_V	0.623	0.31
5_L	51_L	0.621	0.31
40_Y	47_I	0.619	0.31
8_K	37_G	0.618	0.31
89_G	112_K	0.614	0.31
38_G	97_K	0.614	0.31
16_I	19_S	0.606	0.30
76_R	79_N	0.603	0.30
51_L	115_K	0.600	0.30
102_G	110_L	0.598	0.30
48_K	95_V	0.598	0.30
16_I	23_R	0.591	0.29
67_S	70_Q	0.587	0.29
88_K	111_L	0.582	0.29
21_L	25_I	0.581	0.28
99_I	108_K	0.579	0.28
78_I	114_F	0.579	0.28
6_R	39_K	0.575	0.28
12_Q	79_N	0.574	0.28
93_V	107_R	0.572	0.28
76_R	110_L	0.570	0.28
60_V	113_L	0.566	0.27
7_P	24_W	0.564	0.27
11_C	18_Y	0.563	0.27
82_T	86_T	0.562	0.27
11_C	48_K	0.562	0.27
83_N	91_K	0.560	0.27
5_L	43_P	0.556	0.27
31_K	50_Y	0.554	0.27
17_S	30_I	0.554	0.27
109_G	128_M	0.551	0.26
80_Y	85_A	0.550	0.26
90_Y	127_S	0.549	0.26
34_T	39_K	0.548	0.26
22_L	117_V	0.540	0.26
69_D	126_L	0.531	0.25
8_K	28_G	0.528	0.25
51_L	97_K	0.524	0.25
12_Q	104_N	0.522	0.25
6_R	9_E	0.516	0.24
53_K	124_K	0.514	0.24
60_V	94_E	0.507	0.24
25_I	34_T	0.504	0.24
74_L	101_S	0.504	0.24
68_A	99_I	0.502	0.23
89_G	92_V	0.502	0.23
23_R	32_V	0.500	0.23

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3lhkA	2	0.5682	99.7	0.654	Contact Map
2mhcA	1	0.6061	99.6	0.671	Contact Map
3ilxA	2	0.5303	99.6	0.672	Contact Map
3bvpA	4	0.5682	99.6	0.678	Contact Map
3guvA	2	0.5758	99.6	0.681	Contact Map
3whpA	1	0.4545	99.5	0.686	Contact Map
3g13A	2	0.5985	99.5	0.688	Contact Map
4bqqA	2	0.553	99.5	0.696	Contact Map
2gm5A	4	0.4773	99.3	0.728	Contact Map
1gdtA	2	0.5076	99.2	0.735	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0061 seconds.