Q97WZ0 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97WZ0 - Uncharacterized protein

UniProt:	Q97WZ0	Sequences: MRRKILFDTGFFHVYFSGLNEEAKKAVEEVYTGKSVGYTLDLNLAEFLYTYGKLNGVEEANVRLSLILNSPIKIVSTNKELALRAGELKVKYQNLSIVDCFLVAFAEKENTVIYTTDSEIKRVYKNTIILHS	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	132 (121)
Sequences:	108 (94)
Seq/√Len:	8.5

SULSO - Q97WZ0 Q97U93

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
45_A	97_I	3.470	0.95
26_A	114_Y	2.780	0.85
102_L	113_I	2.653	0.82
103_V	123_V	2.566	0.80
30_V	37_G	2.466	0.77
18_G	24_K	2.342	0.73
7_F	37_G	2.302	0.72
30_V	71_P	2.069	0.63
11_F	98_V	2.042	0.62
103_V	113_I	2.015	0.61
40_L	105_F	1.882	0.55
43_N	115_T	1.876	0.55
53_K	116_T	1.810	0.52
82_A	115_T	1.749	0.50
38_Y	60_A	1.680	0.47
102_L	116_T	1.645	0.45
12_F	47_F	1.592	0.43
14_V	19_L	1.584	0.43
10_G	116_T	1.582	0.43
97_I	101_F	1.580	0.43
6_L	14_V	1.575	0.42
37_G	71_P	1.573	0.42
16_F	53_K	1.541	0.41
9_T	15_Y	1.520	0.40
6_L	40_L	1.489	0.39
102_L	115_T	1.465	0.38
48_L	60_A	1.432	0.37
7_F	72_I	1.412	0.36
78_N	108_K	1.371	0.34
40_L	116_T	1.369	0.34
48_L	53_K	1.368	0.34
27_V	70_S	1.330	0.33
15_Y	83_L	1.284	0.31
16_F	116_T	1.264	0.30
97_I	115_T	1.264	0.30
11_F	19_L	1.243	0.30
10_G	115_T	1.240	0.29
44_L	106_A	1.229	0.29
45_A	101_F	1.225	0.29
67_I	88_L	1.208	0.28
43_N	101_F	1.192	0.28
10_G	102_L	1.190	0.28
10_G	82_A	1.187	0.28
24_K	87_E	1.171	0.27
21_E	24_K	1.167	0.27
63_R	104_A	1.162	0.27
45_A	115_T	1.150	0.26
12_F	45_A	1.143	0.26
34_K	104_A	1.142	0.26
10_G	45_A	1.135	0.26
43_N	102_L	1.127	0.26
36_V	73_K	1.126	0.26
22_E	25_K	1.122	0.25
4_K	22_E	1.106	0.25
51_Y	63_R	1.099	0.25
23_A	27_V	1.098	0.25
74_I	88_L	1.098	0.25
35_S	63_R	1.079	0.24
67_I	114_Y	1.062	0.24
24_K	33_G	1.044	0.23
7_F	122_R	1.038	0.23
50_T	118_S	1.032	0.23
29_E	34_K	1.028	0.23
13_H	45_A	1.015	0.22
92_Y	105_F	1.012	0.22
13_H	19_L	1.002	0.22
60_A	85_A	0.992	0.22
42_L	97_I	0.990	0.21
41_D	103_V	0.985	0.21
45_A	116_T	0.984	0.21
101_F	116_T	0.980	0.21
51_Y	113_I	0.977	0.21
88_L	92_Y	0.971	0.21
16_F	85_A	0.971	0.21
6_L	105_F	0.969	0.21
16_F	51_Y	0.967	0.21
31_Y	103_V	0.962	0.21
10_G	113_I	0.961	0.21
68_L	86_G	0.946	0.20
5_I	69_N	0.928	0.20
63_R	100_C	0.924	0.20
26_A	106_A	0.916	0.19
96_S	103_V	0.904	0.19
82_A	116_T	0.903	0.19
11_F	115_T	0.892	0.19
94_N	124_Y	0.891	0.19
47_F	61_N	0.890	0.19
12_F	102_L	0.889	0.19
7_F	110_N	0.887	0.19
96_S	108_K	0.884	0.19
96_S	106_A	0.883	0.19
53_K	102_L	0.879	0.18
4_K	18_G	0.869	0.18
48_L	61_N	0.863	0.18
51_Y	98_V	0.857	0.18
38_Y	113_I	0.854	0.18
38_Y	109_E	0.847	0.18
56_G	111_T	0.837	0.17
42_L	45_A	0.823	0.17
121_K	124_Y	0.809	0.17
8_D	99_D	0.809	0.17
91_K	106_A	0.806	0.17
101_F	115_T	0.793	0.16
4_K	36_V	0.791	0.16
68_L	95_L	0.784	0.16
13_H	25_K	0.784	0.16
17_S	86_G	0.778	0.16
9_T	121_K	0.769	0.16
95_L	120_I	0.763	0.16
84_R	87_E	0.762	0.16
10_G	97_I	0.759	0.16
100_C	105_F	0.758	0.16
18_G	113_I	0.752	0.15
73_K	76_S	0.750	0.15
94_N	112_V	0.741	0.15
86_G	100_C	0.738	0.15
40_L	43_N	0.733	0.15
74_I	95_L	0.733	0.15
11_F	45_A	0.726	0.15
82_A	102_L	0.725	0.15
9_T	118_S	0.724	0.15
92_Y	104_A	0.724	0.15
15_Y	39_T	0.722	0.15
50_T	105_F	0.710	0.15
90_V	113_I	0.710	0.15
9_T	116_T	0.700	0.14
27_V	120_I	0.698	0.14
72_I	75_V	0.695	0.14
8_D	19_L	0.688	0.14
26_A	29_E	0.674	0.14
45_A	82_A	0.674	0.14
75_V	104_A	0.668	0.14
27_V	104_A	0.667	0.14
78_N	81_L	0.666	0.14
5_I	92_Y	0.665	0.14
78_N	101_F	0.665	0.14
33_G	38_Y	0.665	0.14
118_S	121_K	0.663	0.14
42_L	66_L	0.654	0.13
65_S	83_L	0.647	0.13
5_I	27_V	0.646	0.13
84_R	107_E	0.642	0.13
26_A	90_V	0.641	0.13
51_Y	84_R	0.639	0.13
44_L	110_N	0.637	0.13
9_T	13_H	0.635	0.13
100_C	122_R	0.632	0.13
17_S	39_T	0.625	0.13
5_I	123_V	0.625	0.13
61_N	120_I	0.620	0.13
29_E	95_L	0.618	0.13
25_K	113_I	0.608	0.13
67_I	125_K	0.606	0.13
83_L	86_G	0.605	0.12
43_N	116_T	0.604	0.12
11_F	48_L	0.601	0.12
59_E	80_E	0.592	0.12
81_L	84_R	0.588	0.12
23_A	120_I	0.582	0.12
80_E	123_V	0.573	0.12
14_V	27_V	0.571	0.12
102_L	121_K	0.569	0.12
55_N	66_L	0.565	0.12
11_F	90_V	0.564	0.12
90_V	98_V	0.563	0.12
90_V	119_E	0.562	0.12
64_L	113_I	0.561	0.12
13_H	37_G	0.560	0.12
26_A	118_S	0.547	0.11
18_G	33_G	0.543	0.11
23_A	28_E	0.535	0.11
4_K	29_E	0.534	0.11
35_S	84_R	0.531	0.11
31_Y	86_G	0.529	0.11
71_P	113_I	0.528	0.11
64_L	80_E	0.526	0.11
62_V	110_N	0.521	0.11
5_I	39_T	0.519	0.11
34_K	78_N	0.515	0.11
62_V	77_T	0.507	0.11
86_G	89_K	0.504	0.11
20_N	50_T	0.500	0.11

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3zvkA	3	0.9545	99.6	0.639	Contact Map
2h1cA	2	0.9394	99.6	0.646	Contact Map
3tndA	3	0.947	99.6	0.647	Contact Map
1w8iA	2	0.9697	99.6	0.649	Contact Map
1v96A	2	0.9394	99.6	0.651	Contact Map
1v8pA	4	0.8939	99.5	0.661	Contact Map
3h87A	3	0.9318	99.5	0.666	Contact Map
3dboB	1	0.8939	99.5	0.666	Contact Map
2fe1A	2	0.9091	99.5	0.666	Contact Map
4chgA	2	0.9318	99.4	0.691	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.006 seconds.