Q97WY7 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97WY7 - Second ORF in transposon ISC1190

UniProt:	Q97WY7	Sequences: MGIVLSWLRFLLEELERLEGRKREIEKELENVVSKDSLIFTIPGIGKTLGCIILARVGDVRRFSDKKRFVAYCGLDPVVESSGKSVVSRGISKKGDAVLRRAFYLAALTAIKVNLVIKRFYEDHKGRLKGKKLITACARKLAVITWAVLYYNKPFDASE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	159 (149)
Sequences:	4811 (3525)
Seq/√Len:	288.8

SULSO - Q97WY7 Q97YE1 Q97Z62 Q97WZ5 Q97X07 Q97XV5 Q97Y06 Q97ZN4 Q97Y59 Q97X26 Q97UQ6 Q97UF7 Q97XK2 Q97WC0 Q97VS0 Q97X29 Q97X12 Q97VB2 Q7LXX5 Q97XR9 Q97TX3 Q97XM7 Q97UU8

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
69_F	142_A	2.511	1.00
124_H	127_R	2.431	1.00
41_T	154_P	2.322	1.00
38_L	154_P	2.287	1.00
17_R	21_R	2.258	1.00
10_F	21_R	2.242	1.00
13_E	21_R	2.148	1.00
73_C	99_L	2.105	1.00
14_E	17_R	2.082	1.00
53_I	145_T	2.071	1.00
57_V	69_F	2.066	1.00
91_I	135_T	2.054	1.00
15_L	19_E	2.051	1.00
64_S	68_R	2.048	1.00
125_K	131_K	2.021	1.00
118_K	122_E	1.997	1.00
139_R	143_V	1.900	1.00
81_S	86_V	1.883	1.00
65_D	68_R	1.759	1.00
75_L	138_A	1.748	1.00
52_I	102_A	1.710	1.00
14_E	21_R	1.705	1.00
128_L	132_K	1.697	1.00
73_C	142_A	1.693	1.00
38_L	148_V	1.672	1.00
117_I	137_C	1.671	1.00
63_F	72_Y	1.643	1.00
105_L	108_L	1.623	1.00
40_F	47_K	1.581	1.00
42_I	145_T	1.571	1.00
153_K	156_D	1.561	1.00
70_V	76_D	1.548	1.00
12_L	16_E	1.547	1.00
123_D	127_R	1.542	1.00
49_L	102_A	1.537	1.00
147_A	151_Y	1.524	1.00
28_E	31_N	1.507	1.00
120_F	140_K	1.505	1.00
45_I	50_G	1.501	1.00
19_E	22_K	1.452	1.00
22_K	26_E	1.444	1.00
39_I	145_T	1.428	1.00
129_K	132_K	1.418	1.00
104_Y	138_A	1.411	1.00
146_W	150_Y	1.404	1.00
38_L	41_T	1.401	1.00
56_R	96_D	1.395	1.00
30_E	47_K	1.395	1.00
148_V	154_P	1.382	1.00
117_I	144_I	1.378	1.00
121_Y	137_C	1.378	1.00
122_E	126_G	1.362	1.00
70_V	139_R	1.362	1.00
49_L	106_A	1.334	1.00
42_I	148_V	1.313	1.00
23_R	26_E	1.303	1.00
111_I	121_Y	1.268	1.00
42_I	141_L	1.229	1.00
107_A	137_C	1.229	1.00
120_F	124_H	1.210	1.00
101_R	105_L	1.178	1.00
10_F	14_E	1.163	1.00
33_V	40_F	1.161	1.00
144_I	148_V	1.156	1.00
23_R	27_K	1.149	1.00
21_R	24_E	1.136	1.00
107_A	138_A	1.130	1.00
121_Y	133_L	1.126	1.00
107_A	141_L	1.124	1.00
115_L	119_R	1.117	1.00
17_R	20_G	1.115	1.00
120_F	137_C	1.113	1.00
60_V	149_L	1.110	1.00
124_H	133_L	1.103	1.00
104_Y	135_T	1.084	1.00
14_E	18_L	1.078	1.00
106_A	141_L	1.070	1.00
104_Y	108_L	1.069	1.00
13_E	17_R	1.067	1.00
26_E	30_E	1.046	1.00
56_R	98_V	1.036	1.00
120_F	123_D	1.030	1.00
82_S	86_V	1.026	1.00
10_F	24_E	1.016	1.00
147_A	150_Y	0.992	1.00
125_K	130_G	0.986	1.00
10_F	28_E	0.984	1.00
107_A	134_I	0.980	1.00
57_V	60_V	0.978	1.00
125_K	133_L	0.966	1.00
40_F	50_G	0.948	1.00
131_K	134_I	0.946	1.00
103_F	142_A	0.942	1.00
31_N	35_K	0.938	1.00
19_E	23_R	0.937	1.00
39_I	149_L	0.934	1.00
13_E	20_G	0.930	1.00
124_H	129_K	0.918	1.00
28_E	32_V	0.916	1.00
67_K	139_R	0.912	1.00
108_L	111_I	0.902	1.00
119_R	123_D	0.879	1.00
108_L	131_K	0.878	1.00
45_I	145_T	0.877	1.00
27_K	31_N	0.863	1.00
79_V	86_V	0.863	1.00
115_L	118_K	0.861	1.00
45_I	49_L	0.859	1.00
33_V	36_D	0.859	1.00
18_L	22_K	0.850	1.00
30_E	34_S	0.842	1.00
129_K	133_L	0.826	1.00
110_A	117_I	0.820	1.00
124_H	128_L	0.815	1.00
20_G	24_E	0.807	0.99
39_I	50_G	0.805	0.99
68_R	71_A	0.797	0.99
26_E	29_L	0.795	0.99
78_V	92_S	0.792	0.99
72_Y	96_D	0.791	0.99
123_D	126_G	0.788	0.99
93_K	100_R	0.787	0.99
135_T	138_A	0.787	0.99
117_I	141_L	0.783	0.99
91_I	100_R	0.782	0.99
120_F	136_A	0.781	0.99
81_S	87_V	0.779	0.99
53_I	99_L	0.764	0.99
65_D	146_W	0.761	0.99
108_L	134_I	0.761	0.99
75_L	139_R	0.757	0.99
116_V	155_F	0.753	0.99
76_D	92_S	0.738	0.99
27_K	30_E	0.732	0.99
80_E	85_S	0.731	0.99
76_D	79_V	0.726	0.99
52_I	56_R	0.721	0.99
66_K	143_V	0.721	0.99
70_V	143_V	0.717	0.99
25_I	28_E	0.716	0.99
76_D	100_R	0.714	0.99
45_I	141_L	0.713	0.99
76_D	93_K	0.713	0.99
38_L	152_N	0.705	0.99
11_L	14_E	0.704	0.99
16_E	19_E	0.703	0.99
148_V	153_K	0.701	0.99
71_A	76_D	0.700	0.99
111_I	125_K	0.698	0.99
124_H	136_A	0.695	0.98
119_R	122_E	0.695	0.98
91_I	136_A	0.685	0.98
95_G	100_R	0.681	0.98
113_V	118_K	0.675	0.98
143_V	146_W	0.670	0.98
24_E	27_K	0.666	0.98
45_I	53_I	0.661	0.98
61_R	150_Y	0.658	0.98
20_G	23_R	0.651	0.98
24_E	28_E	0.646	0.98
48_T	52_I	0.643	0.98
145_T	148_V	0.643	0.98
108_L	138_A	0.638	0.97
78_V	89_R	0.636	0.97
101_R	104_Y	0.632	0.97
60_V	146_W	0.627	0.97
74_G	100_R	0.624	0.97
144_I	147_A	0.624	0.97
9_R	12_L	0.621	0.97
18_L	21_R	0.621	0.97
42_I	45_I	0.616	0.97
125_K	128_L	0.614	0.97
102_A	106_A	0.606	0.96
10_F	13_E	0.602	0.96
66_K	146_W	0.602	0.96
15_L	18_L	0.600	0.96
36_D	50_G	0.599	0.96
121_Y	125_K	0.596	0.96
76_D	94_K	0.595	0.96
57_V	73_C	0.587	0.96
105_L	109_T	0.581	0.95
106_A	138_A	0.578	0.95
109_T	113_V	0.578	0.95
122_E	125_K	0.575	0.95
84_K	87_V	0.571	0.95
36_D	40_F	0.569	0.95
79_V	88_S	0.569	0.95
44_G	109_T	0.569	0.95
111_I	131_K	0.569	0.95
15_L	22_K	0.567	0.95
36_D	51_C	0.566	0.95
111_I	134_I	0.561	0.95
15_L	26_E	0.558	0.94
108_L	112_K	0.557	0.94
23_R	31_N	0.554	0.94
103_F	138_A	0.548	0.94
16_E	20_G	0.546	0.94
105_L	131_K	0.546	0.94
100_R	135_T	0.543	0.94
92_S	95_G	0.542	0.94
66_K	70_V	0.538	0.93
92_S	100_R	0.533	0.93
52_I	98_V	0.531	0.93
81_S	85_S	0.531	0.93
133_L	137_C	0.530	0.93
13_E	24_E	0.528	0.93
15_L	27_K	0.527	0.93
85_S	88_S	0.526	0.93
51_C	98_V	0.525	0.92
103_F	145_T	0.523	0.92
73_C	96_D	0.520	0.92
106_A	110_A	0.520	0.92
116_V	144_I	0.514	0.92
70_V	75_L	0.511	0.91
47_K	51_C	0.509	0.91
140_K	143_V	0.508	0.91
15_L	23_R	0.505	0.91
59_D	62_R	0.505	0.91
38_L	42_I	0.505	0.91
18_L	34_S	0.504	0.91
41_T	148_V	0.503	0.91
70_V	79_V	0.502	0.91
105_L	138_A	0.501	0.91
114_N	118_K	0.500	0.91

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1keaA	2	0.8302	89.1	0.888	Contact Map
3c65A	1	0.1258	88.9	0.888	Contact Map
3fhfA	1	0.761	88	0.89	Contact Map
1pu6A	1	0.7547	87.2	0.891	Contact Map
2i5hA	1	0.6226	86.5	0.893	Contact Map
3n0uA	1	0.7736	85.5	0.894	Contact Map
4ofaA	1	0.522	85	0.895	Contact Map
2a1jB	2	0.4843	85	0.895	Contact Map
2nrtA	1	0.5409	83.4	0.897	Contact Map
2bgwA	2	0.5786	81.5	0.899	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0071 seconds.