Q97WV1 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97WV1 - Uncharacterized protein

UniProt:	Q97WV1	Sequences: MRRPSKDLALKFLNEAEEFLSKGDLVQACEKYYKAAEEAIKLLVIENNLKEIINDVESKGRWESENLFKASKLLRSNNLEILILWKSAWTLHVEGFHELSLNEKEVKKLKEDVKKLVIFAINS	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	123 (114)
Sequences:	106 (95)
Seq/√Len:	8.9

SULSO - Q97WV1 Q7LX87 Q97WV2 Q97Y35

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
17_E	114_K	3.931	0.98
95_G	98_E	2.560	0.81
68_F	89_W	2.495	0.79
9_A	12_F	2.418	0.77
53_I	56_V	2.342	0.75
22_K	54_N	2.307	0.73
16_A	23_G	2.289	0.73
13_L	35_A	2.273	0.72
94_E	100_S	2.241	0.71
91_L	113_V	2.085	0.65
68_F	101_L	1.943	0.60
51_E	56_V	1.937	0.59
9_A	44_V	1.914	0.58
92_H	98_E	1.858	0.56
49_L	90_T	1.811	0.54
55_D	59_K	1.777	0.53
13_L	117_V	1.767	0.52
86_K	109_L	1.738	0.51
114_K	117_V	1.677	0.48
47_N	74_L	1.672	0.48
92_H	95_G	1.652	0.47
111_E	115_K	1.648	0.47
92_H	97_H	1.639	0.47
56_V	90_T	1.455	0.39
44_V	50_K	1.437	0.38
92_H	96_F	1.425	0.38
53_I	100_S	1.416	0.37
67_L	85_W	1.413	0.37
36_A	87_S	1.406	0.37
64_S	68_F	1.369	0.35
106_V	113_V	1.353	0.35
8_L	61_R	1.348	0.35
68_F	94_E	1.336	0.34
76_S	104_K	1.321	0.34
71_S	76_S	1.295	0.33
49_L	60_G	1.290	0.32
41_K	62_W	1.285	0.32
89_W	92_H	1.273	0.32
21_S	107_K	1.272	0.32
8_L	42_L	1.234	0.30
114_K	118_I	1.194	0.29
15_E	78_N	1.194	0.29
78_N	119_F	1.187	0.29
89_W	116_L	1.182	0.28
14_N	54_N	1.163	0.28
74_L	81_I	1.156	0.28
102_N	108_K	1.137	0.27
75_R	102_N	1.124	0.26
26_V	64_S	1.117	0.26
47_N	117_V	1.098	0.26
107_K	118_I	1.094	0.25
16_A	20_L	1.071	0.25
43_L	85_W	1.068	0.25
82_L	107_K	1.067	0.25
93_V	97_H	1.053	0.24
39_A	116_L	1.032	0.23
40_I	69_K	1.018	0.23
87_S	109_L	0.986	0.22
40_I	78_N	0.983	0.22
90_T	101_L	0.982	0.22
93_V	98_E	0.967	0.21
69_K	102_N	0.960	0.21
5_S	39_A	0.956	0.21
5_S	18_E	0.953	0.21
59_K	74_L	0.941	0.21
102_N	107_K	0.936	0.21
35_A	53_I	0.929	0.20
25_L	32_Y	0.925	0.20
56_V	66_N	0.923	0.20
61_R	92_H	0.913	0.20
31_K	38_E	0.905	0.20
25_L	75_R	0.898	0.20
24_D	49_L	0.895	0.19
7_D	11_K	0.893	0.19
5_S	9_A	0.885	0.19
112_D	116_L	0.885	0.19
80_E	119_F	0.884	0.19
88_A	104_K	0.876	0.19
55_D	58_S	0.860	0.19
61_R	67_L	0.859	0.19
13_L	114_K	0.857	0.18
50_K	88_A	0.841	0.18
68_F	100_S	0.840	0.18
103_E	117_V	0.830	0.18
7_D	20_L	0.830	0.18
93_V	96_F	0.825	0.18
29_C	41_K	0.821	0.18
5_S	100_S	0.811	0.17
49_L	77_N	0.808	0.17
46_E	74_L	0.803	0.17
23_G	85_W	0.801	0.17
36_A	85_W	0.797	0.17
51_E	74_L	0.791	0.17
65_E	74_L	0.788	0.17
26_V	44_V	0.784	0.17
89_W	97_H	0.779	0.17
48_N	67_L	0.778	0.16
104_K	111_E	0.759	0.16
5_S	94_E	0.754	0.16
76_S	108_K	0.751	0.16
17_E	118_I	0.750	0.16
80_E	115_K	0.746	0.16
36_A	101_L	0.737	0.16
14_N	40_I	0.733	0.15
80_E	84_L	0.730	0.15
24_D	41_K	0.718	0.15
78_N	91_L	0.713	0.15
19_F	45_I	0.707	0.15
11_K	40_I	0.700	0.15
35_A	45_I	0.697	0.15
19_F	50_K	0.697	0.15
89_W	95_G	0.692	0.15
28_A	113_V	0.688	0.14
61_R	95_G	0.685	0.14
68_F	90_T	0.684	0.14
61_R	97_H	0.674	0.14
49_L	101_L	0.672	0.14
71_S	103_E	0.668	0.14
56_V	91_L	0.667	0.14
11_K	36_A	0.653	0.14
59_K	63_E	0.653	0.14
87_S	113_V	0.647	0.14
36_A	111_E	0.646	0.14
39_A	69_K	0.644	0.14
23_G	81_I	0.641	0.13
58_S	104_K	0.638	0.13
43_L	78_N	0.637	0.13
17_E	51_E	0.637	0.13
50_K	54_N	0.635	0.13
69_K	118_I	0.635	0.13
24_D	30_E	0.635	0.13
12_F	37_E	0.633	0.13
8_L	99_L	0.630	0.13
20_L	25_L	0.628	0.13
14_N	77_N	0.625	0.13
76_S	81_I	0.621	0.13
18_E	58_S	0.618	0.13
20_L	107_K	0.618	0.13
45_I	54_N	0.617	0.13
80_E	94_E	0.612	0.13
12_F	36_A	0.608	0.13
61_R	93_V	0.607	0.13
67_L	75_R	0.601	0.13
21_S	113_V	0.600	0.13
40_I	66_N	0.598	0.13
48_N	86_K	0.597	0.13
35_A	117_V	0.596	0.13
75_R	83_I	0.592	0.13
13_L	116_L	0.586	0.12
7_D	24_D	0.579	0.12
43_L	67_L	0.578	0.12
74_L	116_L	0.570	0.12
25_L	99_L	0.561	0.12
25_L	107_K	0.561	0.12
93_V	100_S	0.561	0.12
89_W	98_E	0.557	0.12
20_L	101_L	0.554	0.12
60_G	75_R	0.542	0.12
50_K	60_G	0.538	0.12
106_V	114_K	0.537	0.12
72_K	115_K	0.536	0.12
20_L	37_E	0.536	0.12
11_K	14_N	0.535	0.11
58_S	76_S	0.533	0.11
40_I	105_E	0.531	0.11
28_A	38_E	0.518	0.11
13_L	47_N	0.517	0.11
28_A	31_K	0.508	0.11
71_S	89_W	0.505	0.11
79_L	105_E	0.503	0.11
44_V	53_I	0.500	0.11

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2jpuA	1	0.9837	100	0.275	Contact Map
2hsbA	2	0.9106	94.1	0.887	Contact Map
1wolA	1	0.9187	90.5	0.899	Contact Map
1o3uA	2	0.8618	86.7	0.905	Contact Map
3o10A	2	0.9106	84.9	0.908	Contact Map
4nqfA	2	0.9187	84.2	0.909	Contact Map
1ufbA	3	0.9106	76.9	0.915	Contact Map
1knyA	2	0.8211	22.3	0.941	Contact Map
2i7uA	2	0.3496	19.8	0.943	Contact Map
4fzpA	2	0.4146	18.9	0.943	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0058 seconds.