Q97WR2 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97WR2 - Uncharacterized protein

UniProt:	Q97WR2	Sequences: MSETIRNIMRLFPLGIVVVTTKWSDNLVGMTVNTFNSLSLNPPLVMFTADKTKGNDVPFIESNGFIVNFVDDEKIFNTFAFKPIKERFKEAKFFEGLDGIPVLADSYAYMEVKKYKTIDIGDHTIVVGEVINGKIVRDNFSPLVYYNRNYWKLCR	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	155 (146)
Sequences:	4991 (3489)
Seq/√Len:	288.8

ECOLI - RUTF
SULSO - Q97WR2

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
113_K	131_I	3.429	1.00
115_Y	129_E	2.805	1.00
51_K	119_D	2.781	1.00
113_K	129_E	2.672	1.00
76_F	150_Y	2.659	1.00
65_F	128_G	2.545	1.00
94_F	104_A	2.370	1.00
56_D	124_T	2.334	1.00
73_E	77_N	2.038	1.00
117_T	124_T	2.022	1.00
20_T	66_I	1.989	1.00
14_L	33_N	1.977	1.00
60_I	117_T	1.918	1.00
23_W	26_N	1.799	1.00
92_K	104_A	1.795	1.00
96_G	111_E	1.766	1.00
29_G	79_F	1.745	1.00
66_I	102_V	1.735	1.00
109_Y	134_K	1.730	1.00
51_K	124_T	1.720	1.00
48_T	125_I	1.686	1.00
68_N	106_S	1.681	1.00
120_I	125_I	1.665	1.00
35_F	45_V	1.656	1.00
10_R	148_R	1.625	1.00
12_F	15_G	1.607	1.00
77_N	150_Y	1.601	1.00
31_T	76_F	1.578	1.00
98_D	111_E	1.553	1.00
8_I	108_A	1.553	1.00
56_D	60_I	1.535	1.00
112_V	128_G	1.518	1.00
111_E	132_N	1.511	1.00
44_L	127_V	1.509	1.00
118_I	127_V	1.494	1.00
107_Y	140_F	1.480	1.00
86_E	89_K	1.462	1.00
100_I	111_E	1.453	1.00
30_M	49_A	1.420	1.00
36_N	48_T	1.395	1.00
78_T	90_E	1.394	1.00
27_L	95_E	1.383	1.00
8_I	110_M	1.380	1.00
11_L	147_N	1.369	1.00
63_N	114_K	1.337	1.00
5_I	9_M	1.323	1.00
17_V	35_F	1.250	1.00
22_K	95_E	1.242	1.00
36_N	46_M	1.213	1.00
10_R	147_N	1.211	1.00
22_K	27_L	1.209	1.00
30_M	55_N	1.198	1.00
102_V	109_Y	1.198	1.00
46_M	125_I	1.195	1.00
119_D	124_T	1.182	1.00
136_V	140_F	1.170	1.00
45_V	67_V	1.167	1.00
114_K	126_V	1.161	1.00
32_V	35_F	1.151	1.00
44_L	120_I	1.146	1.00
38_L	46_M	1.137	1.00
64_G	113_K	1.133	1.00
22_K	25_D	1.119	1.00
20_T	68_N	1.111	1.00
18_V	79_F	1.106	1.00
21_T	62_S	1.081	1.00
31_T	80_A	1.075	1.00
13_P	144_V	1.071	1.00
18_V	31_T	1.069	1.00
4_T	7_N	1.065	1.00
38_L	120_I	1.030	1.00
65_F	112_V	1.020	1.00
72_D	105_D	1.017	1.00
64_G	100_I	1.014	1.00
98_D	131_I	1.009	1.00
44_L	115_Y	1.007	1.00
56_D	126_V	1.003	1.00
68_N	103_L	1.001	1.00
65_F	114_K	0.994	1.00
117_T	126_V	0.991	1.00
50_D	122_D	0.990	1.00
45_V	110_M	0.979	1.00
78_T	91_A	0.972	1.00
96_G	102_V	0.971	1.00
120_I	127_V	0.959	1.00
57_V	61_E	0.955	1.00
19_V	47_F	0.945	1.00
38_L	48_T	0.945	1.00
74_K	78_T	0.943	1.00
11_L	135_I	0.935	1.00
64_G	131_I	0.925	1.00
97_L	132_N	0.924	1.00
96_G	100_I	0.909	1.00
55_N	59_F	0.893	1.00
107_Y	146_Y	0.888	1.00
9_M	37_S	0.886	1.00
21_T	59_F	0.879	1.00
115_Y	118_I	0.878	1.00
33_N	145_Y	0.869	1.00
29_G	88_F	0.869	1.00
69_F	110_M	0.869	1.00
18_V	75_I	0.856	1.00
68_N	109_Y	0.854	1.00
57_V	60_I	0.854	1.00
141_S	151_W	0.844	1.00
66_I	100_I	0.842	1.00
114_K	117_T	0.838	1.00
6_R	40_L	0.837	1.00
49_A	59_F	0.835	1.00
34_T	47_F	0.832	1.00
102_V	111_E	0.827	1.00
116_K	120_I	0.824	1.00
23_W	62_S	0.820	1.00
71_D	105_D	0.820	1.00
66_I	109_Y	0.820	1.00
44_L	129_E	0.818	1.00
24_S	61_E	0.817	1.00
47_F	126_V	0.817	1.00
116_K	119_D	0.817	1.00
63_N	117_T	0.811	1.00
19_V	32_V	0.809	1.00
15_G	33_N	0.807	0.99
17_V	69_F	0.807	0.99
28_V	58_P	0.806	0.99
98_D	132_N	0.804	0.99
81_F	84_I	0.788	0.99
70_V	76_F	0.786	0.99
27_L	93_F	0.783	0.99
71_D	140_F	0.779	0.99
77_N	81_F	0.774	0.99
74_K	77_N	0.774	0.99
23_W	61_E	0.773	0.99
4_T	135_I	0.772	0.99
17_V	32_V	0.761	0.99
44_L	122_D	0.758	0.99
60_I	124_T	0.752	0.99
13_P	146_Y	0.748	0.99
9_M	45_V	0.747	0.99
55_N	87_R	0.740	0.99
12_F	35_F	0.740	0.99
40_L	122_D	0.738	0.99
145_Y	148_R	0.736	0.99
8_I	133_G	0.736	0.99
9_M	110_M	0.732	0.99
51_K	56_D	0.728	0.99
38_L	127_V	0.726	0.99
54_G	82_K	0.711	0.99
64_G	98_D	0.709	0.99
17_V	67_V	0.707	0.99
145_Y	150_Y	0.694	0.98
20_T	29_G	0.692	0.98
47_F	59_F	0.687	0.98
66_I	111_E	0.685	0.98
19_V	67_V	0.679	0.98
50_D	53_K	0.675	0.98
144_V	151_W	0.674	0.98
59_F	63_N	0.668	0.98
93_F	104_A	0.666	0.98
28_V	87_R	0.665	0.98
44_L	121_G	0.659	0.98
36_N	47_F	0.658	0.98
45_V	112_V	0.657	0.98
4_T	133_G	0.656	0.98
32_V	47_F	0.651	0.98
32_V	67_V	0.649	0.98
73_E	150_Y	0.649	0.98
34_T	37_S	0.647	0.98
116_K	127_V	0.647	0.98
28_V	55_N	0.629	0.97
39_S	44_L	0.625	0.97
54_G	84_I	0.623	0.97
54_G	87_R	0.615	0.97
69_F	108_A	0.611	0.97
60_I	126_V	0.610	0.97
63_N	113_K	0.605	0.96
7_N	148_R	0.605	0.96
49_A	56_D	0.604	0.96
13_P	33_N	0.599	0.96
75_I	103_L	0.597	0.96
71_D	137_R	0.595	0.96
91_A	104_A	0.592	0.96
146_Y	151_W	0.591	0.96
110_M	133_G	0.591	0.96
12_F	33_N	0.586	0.96
59_F	126_V	0.584	0.96
77_N	80_A	0.583	0.96
5_I	43_P	0.579	0.95
147_N	151_W	0.565	0.95
11_L	108_A	0.560	0.95
46_M	120_I	0.558	0.94
27_L	101_P	0.558	0.94
21_T	100_I	0.554	0.94
36_N	125_I	0.551	0.94
6_R	145_Y	0.544	0.94
94_F	134_K	0.544	0.94
31_T	48_T	0.542	0.94
92_K	105_D	0.541	0.93
11_L	137_R	0.540	0.93
142_P	146_Y	0.538	0.93
21_T	28_V	0.536	0.93
23_W	58_P	0.535	0.93
35_F	67_V	0.535	0.93
11_L	146_Y	0.532	0.93
48_T	123_H	0.527	0.93
71_D	74_K	0.524	0.92
92_K	95_E	0.524	0.92
38_L	44_L	0.524	0.92
27_L	88_F	0.523	0.92
110_M	130_V	0.523	0.92
109_Y	133_G	0.518	0.92
17_V	34_T	0.518	0.92
12_F	17_V	0.517	0.92
18_V	29_G	0.513	0.92
26_N	61_E	0.511	0.91
13_P	69_F	0.508	0.91
58_P	62_S	0.506	0.91
33_N	36_N	0.503	0.91
39_S	72_D	0.501	0.91
59_F	114_K	0.500	0.91

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2d37A	2	0.9935	100	0.192	Contact Map
3pftA	2	0.9871	100	0.207	Contact Map
3k86A	2	0.9935	100	0.207	Contact Map
4l82A	2	0.9806	100	0.211	Contact Map
3cb0A	2	0.9935	100	0.215	Contact Map
2r0xA	2	0.9806	100	0.218	Contact Map
3nfwA	2	0.9935	100	0.219	Contact Map
3rh7A	2	0.9806	100	0.222	Contact Map
4r82A	2	0.9806	100	0.23	Contact Map
1rz1A	3	0.9677	100	0.233	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0068 seconds.