Q97WQ4 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97WQ4 - Uncharacterized protein

UniProt:	Q97WQ4	Sequences: MSWEKSGKEGSLLRWYDVMEAERYEYTVGPAGEQFFNGLKQNKIIGSKCSKCGRIFVPARSYCEHCFVKIENYVEINKDEAYVDSYTIIYNDDEGNKLAQPVYIALIRFPNIEGGLLCYAEGNVKVGAKAKILSFQWPLRVKVD	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	144 (121)
Sequences:	590 (347)
Seq/√Len:	31.5

HALSA - Q9HRI9
SULSO - Q97WQ4 Q97WQ5 Q97UW9 Q97VJ8 Q7LXW3 Q97UA6

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
43_K	75_E	3.955	1.00
52_C	66_C	3.918	1.00
49_C	63_C	3.570	1.00
52_C	63_C	3.318	1.00
49_C	52_C	3.068	1.00
44_I	57_V	2.956	1.00
83_V	130_A	2.576	1.00
38_G	45_I	2.530	1.00
80_E	131_K	2.405	0.99
110_P	129_K	2.403	0.99
83_V	105_A	2.372	0.99
63_C	66_C	2.287	0.99
83_V	124_V	2.218	0.99
77_N	80_E	2.216	0.99
84_D	108_R	2.101	0.98
45_I	75_E	2.046	0.98
49_C	66_C	1.990	0.97
107_I	132_I	1.984	0.97
34_Q	73_Y	1.966	0.97
34_Q	37_N	1.907	0.97
38_G	43_K	1.751	0.95
33_E	37_N	1.728	0.94
28_V	36_F	1.662	0.93
81_A	130_A	1.629	0.92
48_K	74_V	1.469	0.87
120_A	124_V	1.456	0.87
80_E	129_K	1.408	0.85
109_F	112_I	1.398	0.85
42_N	136_Q	1.394	0.84
50_S	68_V	1.385	0.84
88_I	103_Y	1.363	0.83
72_N	122_G	1.353	0.83
35_F	39_L	1.263	0.78
118_C	132_I	1.238	0.76
107_I	120_A	1.220	0.75
92_D	101_P	1.200	0.74
43_K	136_Q	1.196	0.74
109_F	132_I	1.190	0.74
37_N	41_Q	1.178	0.73
86_Y	103_Y	1.164	0.72
48_K	53_G	1.159	0.72
76_I	109_F	1.144	0.71
55_I	74_V	1.131	0.70
16_Y	19_M	1.107	0.68
46_G	74_V	1.092	0.67
107_I	118_C	1.091	0.67
14_R	18_V	1.053	0.64
82_Y	129_K	1.047	0.64
105_A	130_A	1.045	0.63
34_Q	38_G	1.043	0.63
93_D	102_V	1.042	0.63
46_G	57_V	1.041	0.63
48_K	72_N	1.031	0.62
34_Q	131_K	1.014	0.61
80_E	110_P	0.987	0.59
121_E	128_A	0.982	0.59
41_Q	75_E	0.978	0.58
108_R	126_V	0.977	0.58
35_F	38_G	0.941	0.55
41_Q	45_I	0.940	0.55
51_K	70_I	0.933	0.55
48_K	55_I	0.929	0.54
76_I	112_I	0.928	0.54
16_Y	20_E	0.921	0.54
47_S	73_Y	0.914	0.53
85_S	93_D	0.914	0.53
67_F	132_I	0.904	0.52
109_F	114_G	0.901	0.52
52_C	68_V	0.893	0.51
57_V	112_I	0.886	0.51
46_G	58_P	0.880	0.50
60_R	88_I	0.858	0.48
55_I	111_N	0.857	0.48
53_G	123_N	0.847	0.48
46_G	90_Y	0.845	0.47
43_K	51_K	0.839	0.47
47_S	56_F	0.835	0.47
28_V	116_L	0.835	0.47
46_G	76_I	0.822	0.46
29_G	107_I	0.819	0.45
57_V	76_I	0.818	0.45
14_R	23_R	0.818	0.45
22_E	102_V	0.816	0.45
105_A	124_V	0.813	0.45
63_C	104_I	0.806	0.44
44_I	109_F	0.801	0.44
59_A	73_Y	0.798	0.44
32_G	36_F	0.795	0.43
39_L	118_C	0.787	0.43
87_T	120_A	0.774	0.42
87_T	104_I	0.763	0.41
18_V	70_I	0.759	0.41
29_G	62_Y	0.759	0.41
81_A	110_P	0.755	0.40
93_D	100_Q	0.752	0.40
38_G	41_Q	0.745	0.39
66_C	136_Q	0.739	0.39
45_I	73_Y	0.737	0.39
107_I	124_V	0.733	0.39
38_G	42_N	0.732	0.38
103_Y	124_V	0.725	0.38
19_M	42_N	0.720	0.38
33_E	110_P	0.717	0.37
14_R	17_D	0.700	0.36
47_S	63_C	0.690	0.35
70_I	135_F	0.685	0.35
49_C	73_Y	0.673	0.34
76_I	117_L	0.672	0.34
35_F	57_V	0.671	0.34
74_V	131_K	0.670	0.34
46_G	55_I	0.670	0.34
20_E	87_T	0.669	0.34
49_C	60_R	0.666	0.33
61_S	70_I	0.665	0.33
31_A	61_S	0.663	0.33
84_D	128_A	0.654	0.33
33_E	107_I	0.651	0.32
23_R	59_A	0.650	0.32
36_F	42_N	0.644	0.32
48_K	100_Q	0.641	0.32
56_F	60_R	0.639	0.32
82_Y	110_P	0.638	0.31
106_L	130_A	0.636	0.31
89_I	102_V	0.633	0.31
87_T	127_G	0.630	0.31
15_W	18_V	0.628	0.31
37_N	131_K	0.624	0.31
38_G	89_I	0.621	0.30
132_I	135_F	0.620	0.30
47_S	52_C	0.620	0.30
48_K	123_N	0.619	0.30
53_G	127_G	0.617	0.30
29_G	97_K	0.614	0.30
26_Y	32_G	0.607	0.29
50_S	72_N	0.597	0.29
35_F	132_I	0.597	0.29
28_V	33_E	0.595	0.29
97_K	135_F	0.595	0.29
27_T	92_D	0.593	0.28
30_P	72_N	0.590	0.28
45_I	77_N	0.590	0.28
14_R	19_M	0.589	0.28
42_N	135_F	0.588	0.28
87_T	90_Y	0.586	0.28
42_N	59_A	0.584	0.28
108_R	115_G	0.578	0.27
50_S	70_I	0.576	0.27
27_T	64_E	0.572	0.27
32_G	56_F	0.571	0.27
77_N	109_F	0.568	0.27
97_K	103_Y	0.567	0.27
86_Y	135_F	0.564	0.27
114_G	117_L	0.560	0.26
50_S	53_G	0.559	0.26
15_W	26_Y	0.557	0.26
95_G	129_K	0.555	0.26
36_F	47_S	0.548	0.26
97_K	137_W	0.548	0.26
102_V	119_Y	0.545	0.25
27_T	39_L	0.545	0.25
80_E	128_A	0.544	0.25
18_V	83_V	0.543	0.25
26_Y	102_V	0.542	0.25
81_A	107_I	0.539	0.25
19_M	22_E	0.537	0.25
104_I	116_L	0.531	0.24
101_P	105_A	0.529	0.24
58_P	76_I	0.527	0.24
18_V	59_A	0.525	0.24
43_K	137_W	0.524	0.24
44_I	83_V	0.524	0.24
47_S	70_I	0.524	0.24
18_V	38_G	0.522	0.24
63_C	68_V	0.519	0.24
108_R	113_E	0.518	0.24
88_I	121_E	0.518	0.24
60_R	80_E	0.514	0.23
48_K	113_E	0.509	0.23
54_R	116_L	0.503	0.23
85_S	91_N	0.502	0.23
17_D	117_L	0.502	0.23
63_C	73_Y	0.500	0.23

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3irbA	3	0.9514	100	0.248	Contact Map
3pwfA	4	0.4931	83.3	0.906	Contact Map
2lcqA	1	0.5347	80.3	0.909	Contact Map
1lkoA	3	0.5208	80.2	0.909	Contact Map
1s24A	1	0.2569	74.1	0.913	Contact Map
1yuzA	2	0.4931	72.8	0.914	Contact Map
4d02A	2	0.1597	67.3	0.918	Contact Map
4tpuA	3	0.5208	64.9	0.919	Contact Map
1yk4A	1	0.2292	61.3	0.921	Contact Map
6rxnA	1	0.2292	58	0.922	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0064 seconds.