Q97WP3 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97WP3 - Uncharacterized protein

UniProt:	Q97WP3	Sequences: MKIFSGKKFEVHIDKVKLPNGYERELEFVKHRGSVVIIPKINNEIILIRQFRPVIDKWIYELPAGTIEEGEDPLNTANRELIEEIGYEAGKMKEIISFYASPGITTEYMRLYLAEDLRYVGAKPEPYEIIEPIRLSIEEAIKMIRERKIEDAKTIIGIFTLKELLE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	166 (157)
Sequences:	5910 (4104)
Seq/√Len:	327.5

ECOLI - NUDE ADPP NUDK
BACSU - ADPP
HALSA - Q9HNS9 Q9HME6
SULSO - Q97WP3

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
36_V	62_L	2.972	1.00
74_L	78_N	2.574	1.00
41_I	44_E	2.551	1.00
91_K	115_E	2.511	1.00
82_I	88_E	2.433	1.00
44_E	134_R	2.364	1.00
44_E	136_S	2.254	1.00
140_A	158_I	2.254	1.00
41_I	134_R	2.189	1.00
60_Y	133_I	2.186	1.00
5_S	10_E	2.165	1.00
142_K	146_E	2.138	1.00
93_K	115_E	2.106	1.00
46_I	134_R	2.067	1.00
72_D	75_N	2.062	1.00
94_E	110_R	2.060	1.00
90_G	116_D	2.042	1.00
49_R	131_E	2.014	1.00
97_S	108_Y	1.976	1.00
30_K	106_T	1.950	1.00
12_H	30_K	1.938	1.00
71_E	79_R	1.922	1.00
143_M	148_K	1.875	1.00
67_I	76_T	1.867	1.00
78_N	92_M	1.835	1.00
15_K	23_E	1.815	1.00
17_K	23_E	1.801	1.00
37_I	77_A	1.776	1.00
49_R	133_I	1.769	1.00
94_E	97_S	1.754	1.00
135_L	143_M	1.735	1.00
73_P	110_R	1.722	1.00
50_Q	61_E	1.675	1.00
90_G	118_R	1.666	1.00
13_I	25_E	1.665	1.00
136_S	139_E	1.635	1.00
88_E	118_R	1.601	1.00
97_S	110_R	1.598	1.00
14_D	53_P	1.558	1.00
81_L	89_A	1.538	1.00
15_K	25_E	1.527	1.00
91_K	116_D	1.496	1.00
139_E	142_K	1.489	1.00
75_N	78_N	1.475	1.00
99_Y	150_E	1.468	1.00
38_I	157_G	1.438	1.00
74_L	92_M	1.429	1.00
62_L	157_G	1.400	1.00
76_T	79_R	1.391	1.00
57_K	150_E	1.389	1.00
67_I	73_P	1.388	1.00
46_I	87_Y	1.327	1.00
13_I	27_E	1.320	1.00
98_F	156_I	1.291	1.00
88_E	120_V	1.291	1.00
73_P	112_Y	1.257	1.00
78_N	82_I	1.234	1.00
53_P	56_D	1.228	1.00
82_I	120_V	1.215	1.00
82_I	123_K	1.191	1.00
55_I	99_Y	1.183	1.00
55_I	59_I	1.181	1.00
135_L	140_A	1.175	1.00
144_I	155_I	1.169	1.00
94_E	112_Y	1.162	1.00
63_P	85_I	1.161	1.00
87_Y	119_Y	1.161	1.00
6_G	27_E	1.159	1.00
98_F	111_L	1.156	1.00
39_P	81_L	1.153	1.00
141_I	145_R	1.123	1.00
43_N	137_I	1.119	1.00
49_R	58_W	1.107	1.00
101_S	107_E	1.105	1.00
46_I	132_P	1.097	1.00
142_K	145_R	1.095	1.00
19_P	129_I	1.082	1.00
38_I	161_L	1.076	1.00
139_E	143_M	1.072	1.00
71_E	76_T	1.049	1.00
111_L	157_G	1.040	1.00
33_G	67_I	1.040	1.00
14_D	28_F	1.027	1.00
35_V	77_A	1.008	1.00
51_F	56_D	1.008	1.00
95_I	113_L	0.984	1.00
38_I	45_I	0.965	1.00
116_D	121_G	0.958	1.00
151_D	154_T	0.956	1.00
156_I	159_F	0.944	1.00
141_I	158_I	0.937	1.00
59_I	102_P	0.931	1.00
34_S	109_M	0.924	1.00
92_M	112_Y	0.902	1.00
89_A	92_M	0.899	1.00
77_A	92_M	0.885	1.00
33_G	108_Y	0.873	1.00
40_K	137_I	0.862	1.00
41_I	87_Y	0.860	1.00
52_R	61_E	0.856	1.00
116_D	120_V	0.851	1.00
31_H	107_E	0.843	1.00
29_V	104_I	0.839	1.00
40_K	113_L	0.834	1.00
74_L	94_E	0.831	1.00
37_I	114_A	0.830	1.00
47_L	60_Y	0.828	1.00
124_P	127_Y	0.824	1.00
62_L	158_I	0.823	1.00
123_K	128_E	0.820	1.00
36_V	109_M	0.819	1.00
10_E	30_K	0.811	1.00
45_I	62_L	0.811	1.00
99_Y	108_Y	0.807	1.00
58_W	129_I	0.796	1.00
45_I	158_I	0.793	1.00
124_P	130_I	0.792	1.00
117_L	120_V	0.790	1.00
100_A	104_I	0.783	1.00
28_F	53_P	0.776	1.00
92_M	114_A	0.775	1.00
38_I	62_L	0.773	1.00
82_I	121_G	0.773	1.00
89_A	114_A	0.770	1.00
78_N	88_E	0.767	1.00
45_I	161_L	0.766	1.00
63_P	81_L	0.757	0.99
36_V	153_K	0.756	0.99
36_V	111_L	0.754	0.99
117_L	121_G	0.742	0.99
47_L	133_I	0.741	0.99
43_N	138_E	0.739	0.99
33_G	110_R	0.738	0.99
35_V	73_P	0.737	0.99
60_Y	135_L	0.730	0.99
47_L	135_L	0.729	0.99
40_K	45_I	0.729	0.99
144_I	149_I	0.724	0.99
125_E	128_E	0.722	0.99
93_K	113_L	0.719	0.99
40_K	43_N	0.717	0.99
143_M	146_E	0.714	0.99
42_N	134_R	0.708	0.99
96_I	156_I	0.707	0.99
17_K	21_G	0.692	0.99
39_P	113_L	0.692	0.99
122_A	132_P	0.673	0.99
16_V	53_P	0.670	0.99
108_Y	150_E	0.669	0.99
101_S	105_T	0.668	0.99
109_M	153_K	0.668	0.99
122_A	125_E	0.668	0.99
98_F	152_A	0.668	0.99
45_I	137_I	0.665	0.99
40_K	161_L	0.661	0.99
140_A	144_I	0.660	0.99
48_I	130_I	0.655	0.99
40_K	115_E	0.649	0.98
89_A	117_L	0.641	0.98
97_S	150_E	0.640	0.98
16_V	24_R	0.638	0.98
49_R	60_Y	0.638	0.98
37_I	63_P	0.635	0.98
18_L	22_Y	0.633	0.98
20_N	129_I	0.632	0.98
137_I	141_I	0.632	0.98
74_L	112_Y	0.632	0.98
39_P	48_I	0.626	0.98
39_P	89_A	0.625	0.98
133_I	143_M	0.619	0.98
60_Y	143_M	0.617	0.98
91_K	94_E	0.615	0.98
156_I	160_T	0.614	0.98
100_A	152_A	0.613	0.98
47_L	140_A	0.612	0.98
39_P	62_L	0.610	0.98
139_E	148_K	0.604	0.98
96_I	160_T	0.603	0.98
7_K	13_I	0.592	0.97
11_V	29_V	0.589	0.97
45_I	140_A	0.588	0.97
37_I	81_L	0.586	0.97
67_I	110_R	0.585	0.97
6_G	13_I	0.583	0.97
34_S	66_T	0.581	0.97
64_A	153_K	0.580	0.97
36_V	64_A	0.580	0.97
89_A	116_D	0.580	0.97
59_I	99_Y	0.579	0.97
41_I	46_I	0.576	0.97
32_R	66_T	0.575	0.97
77_A	81_L	0.574	0.97
123_K	127_Y	0.573	0.97
31_H	104_I	0.573	0.97
138_E	141_I	0.571	0.97
77_A	112_Y	0.570	0.97
136_S	141_I	0.569	0.96
64_A	103_G	0.566	0.96
122_A	128_E	0.563	0.96
135_L	139_E	0.560	0.96
52_R	103_G	0.559	0.96
140_A	149_I	0.555	0.96
14_D	56_D	0.555	0.96
104_I	109_M	0.554	0.96
72_D	112_Y	0.552	0.96
33_G	66_T	0.552	0.96
28_F	54_V	0.551	0.96
98_F	155_I	0.550	0.96
149_I	154_T	0.548	0.96
96_I	147_R	0.545	0.96
96_I	155_I	0.544	0.95
31_H	105_T	0.543	0.95
143_M	149_I	0.541	0.95
124_P	128_E	0.539	0.95
118_R	121_G	0.537	0.95
144_I	158_I	0.533	0.95
93_K	96_I	0.530	0.95
100_A	105_T	0.529	0.95
6_G	26_L	0.527	0.95
11_V	27_E	0.524	0.94
138_E	142_K	0.524	0.94
80_E	84_E	0.523	0.94
31_H	64_A	0.522	0.94
155_I	159_F	0.521	0.94
64_A	101_S	0.519	0.94
48_I	59_I	0.518	0.94
68_E	76_T	0.517	0.94
96_I	111_L	0.515	0.94
20_N	127_Y	0.510	0.94
7_K	25_E	0.509	0.94
116_D	119_Y	0.509	0.94
18_L	24_R	0.508	0.94
24_R	127_Y	0.507	0.93
144_I	159_F	0.506	0.93
154_T	158_I	0.502	0.93
34_S	107_E	0.500	0.93

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1vhzA	2	1	100	0.291	Contact Map
1g0sA	2	0.994	100	0.299	Contact Map
2dscA	2	0.994	100	0.319	Contact Map
1mk1A	2	0.9217	100	0.358	Contact Map
3o6zA	2	0.988	100	0.39	Contact Map
2yvpA	2	0.9819	100	0.403	Contact Map
1v8yA	2	0.8916	100	0.424	Contact Map
3q91A	2	0.759	100	0.437	Contact Map
2w4eA	2	0.7892	99.9	0.488	Contact Map
2fvvA	1	0.8012	99.9	0.554	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0072 seconds.