Q97WM7 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97WM7 - Uncharacterized protein

UniProt:	Q97WM7	Sequences: MNIQRISVIIVSAQTSISQALSGIATSIIDAIPSIILFVIILLVGYIIGNIVAYSIRTFLGRIFREEHVRASVDIIAGTVKALIILIALSIALSFLQLGAASGYIQQIANYLPKLAGAIVLLTIGLTLVNILVDYMQRQIGARSQDDLITAIFNVLRFGLYAAIITVAAALAIFSVIPYVDPYVFYAVILGAVILYAAYALIDKVLVPFANSNPDLAYVANYGRFILYIIVLLIAIAIIVEPFGNVTSIIYALSWGLAIAFAIALIPLVIALVKKFLAEIK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	281 (227)
Sequences:	127 (95)
Seq/√Len:	6.3

SULSO - Q97WM7

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
173_I	187_A	4.035	0.95
196_Y	200_A	3.180	0.84
48_I	89_L	3.050	0.81
60_L	168_A	2.946	0.78
49_G	84_I	2.781	0.74
222_Y	233_L	2.725	0.72
122_L	168_A	2.660	0.70
32_I	93_L	2.571	0.68
132_L	160_L	2.559	0.67
45_G	92_A	2.545	0.67
38_F	92_A	2.480	0.65
225_F	228_Y	2.433	0.63
60_L	118_A	2.362	0.61
44_V	48_I	2.304	0.59
73_V	171_L	2.263	0.57
48_I	173_I	2.260	0.57
160_L	187_A	2.056	0.50
80_V	185_F	2.026	0.49
41_I	92_A	1.992	0.47
49_G	85_I	1.973	0.47
39_V	183_Y	1.927	0.45
162_A	193_V	1.903	0.44
97_Q	121_L	1.874	0.43
44_V	55_S	1.838	0.42
42_L	92_A	1.830	0.42
35_I	69_V	1.829	0.42
96_L	207_V	1.779	0.40
121_L	136_M	1.756	0.39
32_I	136_M	1.723	0.38
223_G	228_Y	1.713	0.38
159_G	200_A	1.679	0.36
197_A	200_A	1.647	0.35
142_A	168_A	1.576	0.33
149_I	183_Y	1.570	0.33
72_S	187_A	1.569	0.33
97_Q	129_V	1.556	0.32
108_I	137_Q	1.551	0.32
107_Q	160_L	1.538	0.32
73_V	89_L	1.528	0.32
98_L	121_L	1.525	0.31
64_F	177_I	1.524	0.31
169_A	209_F	1.517	0.31
119_I	173_I	1.509	0.31
81_K	200_A	1.507	0.31
183_Y	186_Y	1.497	0.31
162_A	185_F	1.476	0.30
22_S	59_F	1.469	0.30
45_G	207_V	1.460	0.29
36_I	52_V	1.450	0.29
36_I	152_I	1.426	0.28
119_I	239_I	1.399	0.28
81_K	207_V	1.393	0.27
111_Y	205_V	1.376	0.27
72_S	133_V	1.367	0.27
32_I	192_A	1.362	0.27
152_I	173_I	1.356	0.26
119_I	152_I	1.346	0.26
118_A	168_A	1.344	0.26
121_L	159_G	1.336	0.26
160_L	175_S	1.335	0.26
164_I	176_V	1.322	0.25
115_L	179_Y	1.321	0.25
13_A	16_S	1.321	0.25
117_G	209_F	1.319	0.25
17_I	52_V	1.313	0.25
60_L	80_V	1.307	0.25
167_V	222_Y	1.306	0.25
40_I	127_T	1.272	0.24
66_E	198_A	1.264	0.24
118_A	174_F	1.256	0.24
77_A	84_I	1.248	0.23
224_R	231_V	1.246	0.23
174_F	213_N	1.231	0.23
112_L	190_L	1.231	0.23
140_I	197_A	1.228	0.23
53_A	184_V	1.225	0.23
37_L	85_I	1.217	0.23
31_A	35_I	1.214	0.23
72_S	83_L	1.209	0.22
48_I	76_I	1.207	0.22
68_H	118_A	1.199	0.22
45_G	73_V	1.198	0.22
23_G	90_S	1.195	0.22
56_I	116_A	1.182	0.22
87_I	191_G	1.181	0.22
48_I	126_L	1.177	0.22
118_A	171_L	1.175	0.22
157_R	171_L	1.169	0.21
55_S	128_L	1.155	0.21
157_R	233_L	1.154	0.21
213_N	221_N	1.151	0.21
105_I	116_A	1.147	0.21
202_I	240_V	1.138	0.21
92_A	210_A	1.137	0.21
35_I	43_L	1.131	0.21
37_L	204_K	1.131	0.21
69_V	215_D	1.130	0.21
16_S	117_G	1.126	0.20
29_I	119_I	1.121	0.20
48_I	119_I	1.121	0.20
51_I	69_V	1.115	0.20
59_F	131_I	1.095	0.20
183_Y	204_K	1.089	0.20
112_L	115_L	1.088	0.20
216_L	237_A	1.087	0.20
37_L	206_L	1.087	0.20
76_I	142_A	1.085	0.19
31_A	177_I	1.082	0.19
84_I	189_I	1.072	0.19
99_G	112_L	1.066	0.19
32_I	79_T	1.062	0.19
115_L	149_I	1.056	0.19
51_I	168_A	1.054	0.19
27_S	226_I	1.048	0.19
31_A	162_A	1.045	0.19
92_A	207_V	1.043	0.19
77_A	193_V	1.031	0.18
88_A	202_I	1.026	0.18
141_G	145_Q	1.023	0.18
233_L	242_P	1.020	0.18
111_Y	150_T	1.011	0.18
43_L	47_I	1.007	0.18
20_A	109_A	1.004	0.18
230_I	235_A	1.000	0.18
36_I	57_R	0.999	0.18
92_A	96_L	0.995	0.18
47_I	79_T	0.995	0.18
35_I	101_A	0.987	0.17
60_L	235_A	0.986	0.17
45_G	160_L	0.986	0.17
47_I	75_I	0.984	0.17
222_Y	232_L	0.978	0.17
42_L	196_Y	0.972	0.17
13_A	77_A	0.969	0.17
67_E	85_I	0.969	0.17
78_G	127_T	0.963	0.17
85_I	111_Y	0.958	0.17
35_I	228_Y	0.952	0.17
17_I	222_Y	0.947	0.17
147_D	192_A	0.944	0.16
61_G	94_S	0.944	0.16
133_V	157_R	0.943	0.16
53_A	78_G	0.943	0.16
178_P	200_A	0.936	0.16
163_A	170_A	0.924	0.16
92_A	203_D	0.922	0.16
65_R	183_Y	0.921	0.16
43_L	103_G	0.917	0.16
112_L	232_L	0.915	0.16
41_I	155_V	0.915	0.16
132_L	168_A	0.910	0.16
62_R	138_R	0.910	0.16
68_H	153_F	0.897	0.16
56_I	87_I	0.894	0.15
74_D	101_A	0.893	0.15
29_I	162_A	0.885	0.15
122_L	237_A	0.885	0.15
45_G	88_A	0.880	0.15
176_V	205_V	0.879	0.15
22_S	89_L	0.874	0.15
122_L	188_V	0.870	0.15
114_K	222_Y	0.867	0.15
145_Q	209_F	0.867	0.15
90_S	94_S	0.864	0.15
85_I	150_T	0.858	0.15
146_D	190_L	0.855	0.15
102_S	236_I	0.854	0.15
88_A	96_L	0.850	0.15
56_I	236_I	0.848	0.15
114_K	175_S	0.848	0.15
115_L	161_Y	0.846	0.15
115_L	182_P	0.844	0.15
64_F	188_V	0.843	0.15
148_L	172_A	0.837	0.14
44_V	101_A	0.833	0.14
166_T	237_A	0.832	0.14
179_Y	188_V	0.830	0.14
46_Y	175_S	0.827	0.14
132_L	135_Y	0.818	0.14
43_L	215_D	0.816	0.14
86_L	89_L	0.813	0.14
39_V	194_I	0.812	0.14
102_S	202_I	0.807	0.14
221_N	224_R	0.807	0.14
101_A	111_Y	0.806	0.14
130_N	159_G	0.806	0.14
203_D	206_L	0.798	0.14
74_D	103_G	0.797	0.14
24_I	55_S	0.797	0.14
76_I	126_L	0.795	0.14
73_V	157_R	0.792	0.14
112_L	117_G	0.791	0.14
226_I	241_E	0.790	0.14
106_Q	145_Q	0.790	0.14
119_I	233_L	0.786	0.14
35_I	120_V	0.784	0.14
145_Q	208_P	0.780	0.13
66_E	202_I	0.779	0.13
121_L	186_Y	0.779	0.13
121_L	200_A	0.775	0.13
201_L	209_F	0.771	0.13
124_I	188_V	0.771	0.13
75_I	97_Q	0.764	0.13
46_Y	238_I	0.759	0.13
79_T	136_M	0.759	0.13
99_G	162_A	0.758	0.13
190_L	215_D	0.758	0.13
38_F	168_A	0.755	0.13
117_G	185_F	0.750	0.13
171_L	192_A	0.745	0.13
221_N	231_V	0.743	0.13
168_A	237_A	0.737	0.13
77_A	112_L	0.734	0.13
227_L	232_L	0.732	0.13
70_R	76_I	0.730	0.13
67_E	152_I	0.729	0.13
161_Y	228_Y	0.728	0.13
202_I	218_Y	0.725	0.13
175_S	193_V	0.722	0.12
30_D	43_L	0.722	0.12
93_L	174_F	0.717	0.12
21_L	182_P	0.713	0.12
146_D	228_Y	0.712	0.12
43_L	56_I	0.707	0.12
92_A	152_I	0.704	0.12
127_T	238_I	0.702	0.12
159_G	187_A	0.699	0.12
17_I	56_I	0.692	0.12
73_V	205_V	0.685	0.12
98_L	159_G	0.682	0.12
231_V	236_I	0.682	0.12
222_Y	231_V	0.676	0.12
205_V	209_F	0.674	0.12
177_I	197_A	0.673	0.12
194_I	219_V	0.671	0.12
166_T	172_A	0.669	0.12
93_L	102_S	0.665	0.12
163_A	208_P	0.664	0.12
42_L	128_L	0.659	0.12
41_I	86_L	0.656	0.11
97_Q	206_L	0.651	0.11
153_F	194_I	0.651	0.11
66_E	129_V	0.651	0.11
166_T	178_P	0.648	0.11
188_V	194_I	0.645	0.11
58_T	152_I	0.644	0.11
73_V	211_N	0.644	0.11
91_I	205_V	0.639	0.11
68_H	139_Q	0.638	0.11
50_N	132_L	0.638	0.11
85_I	119_I	0.633	0.11
64_F	81_K	0.631	0.11
77_A	199_Y	0.630	0.11
75_I	152_I	0.629	0.11
88_A	92_A	0.628	0.11
149_I	194_I	0.627	0.11
129_V	197_A	0.627	0.11
94_S	153_F	0.625	0.11
38_F	45_G	0.623	0.11
133_V	161_Y	0.622	0.11
65_R	93_L	0.619	0.11
132_L	202_I	0.618	0.11
52_V	155_V	0.616	0.11
31_A	43_L	0.612	0.11
40_I	225_F	0.612	0.11
105_I	110_N	0.612	0.11
201_L	231_V	0.610	0.11
116_A	134_D	0.609	0.11
87_I	132_L	0.608	0.11
128_L	154_N	0.606	0.11
68_H	213_N	0.606	0.11
103_G	147_D	0.605	0.11
32_I	135_Y	0.605	0.11
87_I	194_I	0.603	0.11
22_S	123_T	0.598	0.11
46_Y	172_A	0.597	0.11
52_V	89_L	0.593	0.11
31_A	208_P	0.593	0.11
105_I	160_L	0.592	0.11
40_I	202_I	0.591	0.11
65_R	173_I	0.588	0.11
116_A	211_N	0.588	0.11
34_S	49_G	0.586	0.10
105_I	132_L	0.585	0.10
44_V	184_V	0.582	0.10
193_V	218_Y	0.581	0.10
48_I	203_D	0.579	0.10
85_I	112_L	0.577	0.10
47_I	59_F	0.577	0.10
76_I	203_D	0.575	0.10
90_S	233_L	0.575	0.10
122_L	186_Y	0.574	0.10
126_L	170_A	0.573	0.10
59_F	123_T	0.573	0.10
50_N	224_R	0.573	0.10
25_A	41_I	0.570	0.10
25_A	89_L	0.569	0.10
167_V	205_V	0.565	0.10
119_I	168_A	0.563	0.10
124_I	214_P	0.561	0.10
40_I	116_A	0.560	0.10
50_N	102_S	0.556	0.10
128_L	168_A	0.555	0.10
194_I	199_Y	0.554	0.10
94_S	99_G	0.554	0.10
120_V	162_A	0.552	0.10
85_I	155_V	0.552	0.10
134_D	173_I	0.551	0.10
73_V	110_N	0.551	0.10
44_V	51_I	0.550	0.10
92_A	240_V	0.549	0.10
19_Q	122_L	0.545	0.10
191_G	217_A	0.544	0.10
46_Y	65_R	0.543	0.10
145_Q	199_Y	0.542	0.10
45_G	117_G	0.541	0.10
29_I	63_I	0.541	0.10
105_I	145_Q	0.541	0.10
72_S	99_G	0.537	0.10
43_L	146_D	0.536	0.10
39_V	45_G	0.535	0.10
174_F	212_S	0.530	0.10
98_L	197_A	0.527	0.10
112_L	211_N	0.524	0.10
49_G	145_Q	0.523	0.10
111_Y	230_I	0.523	0.10
115_L	184_V	0.522	0.10
201_L	205_V	0.521	0.10
37_L	40_I	0.519	0.10
171_L	180_V	0.519	0.10
13_A	86_L	0.513	0.10
115_L	168_A	0.513	0.10
30_D	203_D	0.511	0.10
55_S	150_T	0.509	0.09
50_N	80_V	0.508	0.09
42_L	96_L	0.507	0.09
28_I	122_L	0.503	0.09
111_Y	177_I	0.502	0.09
133_V	174_F	0.502	0.09
81_K	239_I	0.500	0.09

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
5ajiA	3	0.6085	99.1	0.839	Contact Map
4hw9A	3	0.5765	99.1	0.845	Contact Map
3udcA	3	0.5907	98.8	0.859	Contact Map
4czbA	2	0.8399	17	0.964	Contact Map
3e8tA	1	0.2206	14.1	0.965	Contact Map
4cz8A	2	0.8256	6.6	0.97	Contact Map
4xk8J	1	0.1352	6	0.97	Contact Map
2rqfA	1	0.2384	4.3	0.972	Contact Map
4gh4D	3	0.1246	3.9	0.973	Contact Map
4bwzA	2	0.8078	3.7	0.973	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0084 seconds.