NUCS - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

NUCS - Endonuclease NucS

UniProt:	Q97WK8	Sequences: MYSVLLNPSNTEIYSFLTDRIYRELIVIFATCKVNYKGRAESVASESPRLIILKPDGTVIIHESVKREPLNWQPPGTKIEIMNDYPLKIVAQRNRPKEVIEIDLKEVFYITSAEVKEGDFTIKGREIDIVNTIIQNPSMIEEGFVPLTREYNTPYGKIDLIGLDKKGNFVIIEVKRSKAQLNAISQLYRYYLHMREIKGDKIRGILVAPDLTIHARELLQKLGLEFIRYDIKNYSS	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	236 (208)
Sequences:	453 (174)
Seq/√Len:	12.1

HALSA - NUCS2 NUCS1
SULSO - NUCS

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
137_P	160_L	6.057	1.00
203_R	225_E	5.434	1.00
191_Y	224_L	4.686	1.00
60_I	66_K	4.360	1.00
137_P	162_G	3.964	0.99
60_I	65_V	3.078	0.96
59_V	102_I	2.925	0.95
128_D	131_N	2.661	0.92
35_N	43_V	2.612	0.91
46_E	105_K	2.549	0.90
51_I	61_I	2.521	0.90
28_I	51_I	2.498	0.89
184_I	215_A	2.440	0.88
94_N	98_E	2.423	0.87
139_M	233_N	2.388	0.87
137_P	229_Y	2.386	0.87
137_P	144_F	2.358	0.86
136_N	139_M	2.351	0.86
31_T	48_P	2.345	0.86
140_I	229_Y	2.275	0.84
140_I	172_I	2.260	0.83
164_D	203_R	2.252	0.83
60_I	63_E	2.205	0.82
139_M	144_F	2.029	0.76
137_P	174_V	2.012	0.75
205_I	225_E	2.002	0.75
161_I	169_F	1.934	0.72
93_R	96_P	1.882	0.70
93_R	98_E	1.792	0.66
220_Q	225_E	1.765	0.65
109_Y	113_A	1.732	0.63
141_E	144_F	1.731	0.63
31_T	105_K	1.731	0.63
180_Q	212_T	1.717	0.63
172_I	205_I	1.687	0.61
30_A	104_L	1.656	0.60
144_F	160_L	1.633	0.59
52_I	65_V	1.604	0.57
144_F	162_G	1.596	0.57
152_N	194_M	1.590	0.57
48_P	108_F	1.586	0.56
141_E	203_R	1.539	0.54
140_I	144_F	1.535	0.54
98_E	103_D	1.526	0.53
89_I	98_E	1.506	0.52
160_L	229_Y	1.473	0.51
63_E	66_K	1.466	0.50
89_I	93_R	1.432	0.49
27_V	50_L	1.423	0.48
89_I	101_E	1.389	0.47
74_P	96_P	1.383	0.46
138_S	142_E	1.343	0.44
162_G	174_V	1.338	0.44
177_S	210_D	1.336	0.44
143_G	164_D	1.336	0.44
64_S	177_S	1.334	0.44
42_S	73_Q	1.287	0.41
51_I	102_I	1.285	0.41
32_C	44_A	1.280	0.41
140_I	225_E	1.278	0.41
44_A	120_F	1.272	0.41
160_L	174_V	1.265	0.40
147_L	161_I	1.262	0.40
128_D	180_Q	1.254	0.40
92_Q	97_K	1.252	0.40
58_T	207_V	1.221	0.38
41_E	136_N	1.221	0.38
51_I	95_R	1.220	0.38
89_I	92_Q	1.205	0.38
194_M	229_Y	1.202	0.37
94_N	102_I	1.190	0.37
127_I	130_V	1.188	0.37
124_G	189_R	1.173	0.36
101_E	131_N	1.169	0.36
205_I	212_T	1.114	0.33
107_V	136_N	1.113	0.33
89_I	96_P	1.100	0.33
51_I	104_L	1.091	0.32
33_K	233_N	1.080	0.32
100_I	218_L	1.078	0.32
162_G	169_F	1.071	0.31
52_I	66_K	1.058	0.31
60_I	95_R	1.046	0.30
113_A	180_Q	1.045	0.30
74_P	180_Q	1.035	0.30
85_Y	93_R	1.020	0.29
98_E	136_N	1.014	0.29
144_F	174_V	1.005	0.29
50_L	95_R	1.001	0.28
57_G	62_H	1.000	0.28
90_V	96_P	0.990	0.28
147_L	169_F	0.987	0.28
152_N	161_I	0.982	0.28
137_P	201_K	0.970	0.27
162_G	229_Y	0.969	0.27
182_N	195_R	0.960	0.27
34_V	44_A	0.958	0.27
93_R	210_D	0.951	0.26
90_V	98_E	0.949	0.26
74_P	93_R	0.948	0.26
67_R	185_S	0.940	0.26
28_I	34_V	0.932	0.26
30_A	51_I	0.911	0.25
93_R	168_N	0.910	0.25
102_I	230_D	0.910	0.25
25_L	35_N	0.909	0.25
195_R	223_G	0.905	0.25
46_E	121_T	0.901	0.25
34_V	62_H	0.900	0.25
144_F	203_R	0.898	0.24
98_E	105_K	0.898	0.24
106_E	138_S	0.898	0.24
125_R	199_G	0.894	0.24
101_E	233_N	0.884	0.24
37_K	99_V	0.880	0.24
31_T	106_E	0.880	0.24
30_A	181_L	0.874	0.24
67_R	76_G	0.868	0.23
216_R	223_G	0.867	0.23
129_I	157_K	0.860	0.23
47_S	70_L	0.860	0.23
140_I	160_L	0.859	0.23
168_N	203_R	0.858	0.23
92_Q	98_E	0.858	0.23
87_L	162_G	0.852	0.23
155_Y	193_H	0.839	0.22
67_R	125_R	0.838	0.22
41_E	131_N	0.837	0.22
37_K	111_T	0.826	0.22
90_V	93_R	0.822	0.22
29_F	104_L	0.822	0.22
93_R	137_P	0.821	0.22
203_R	227_I	0.806	0.21
183_A	206_L	0.805	0.21
34_V	57_G	0.804	0.21
74_P	224_L	0.801	0.21
130_V	149_R	0.800	0.21
48_P	112_S	0.793	0.21
41_E	139_M	0.791	0.21
216_R	220_Q	0.787	0.21
162_G	172_I	0.787	0.21
48_P	229_Y	0.786	0.21
142_E	165_K	0.785	0.20
188_Y	222_L	0.780	0.20
89_I	166_K	0.775	0.20
121_T	180_Q	0.772	0.20
144_F	229_Y	0.772	0.20
33_K	46_E	0.770	0.20
47_S	73_Q	0.767	0.20
139_M	162_G	0.765	0.20
47_S	76_G	0.763	0.20
120_F	177_S	0.757	0.20
195_R	221_K	0.754	0.19
97_K	206_L	0.751	0.19
40_A	122_I	0.750	0.19
42_S	209_P	0.750	0.19
92_Q	99_V	0.749	0.19
145_V	163_L	0.747	0.19
48_P	106_E	0.741	0.19
183_A	231_I	0.740	0.19
91_A	98_E	0.740	0.19
153_T	158_I	0.738	0.19
92_Q	96_P	0.733	0.19
192_L	229_Y	0.728	0.19
144_F	172_I	0.724	0.19
66_K	93_R	0.724	0.19
36_Y	71_N	0.717	0.18
65_V	89_I	0.715	0.18
44_A	49_R	0.715	0.18
86_P	98_E	0.713	0.18
137_P	141_E	0.711	0.18
58_T	67_R	0.709	0.18
111_T	167_G	0.703	0.18
51_I	75_P	0.700	0.18
64_S	120_F	0.700	0.18
182_N	215_A	0.698	0.18
152_N	202_I	0.697	0.18
52_I	74_P	0.695	0.18
88_K	96_P	0.694	0.18
85_Y	167_G	0.694	0.18
86_P	89_I	0.693	0.18
153_T	182_N	0.690	0.18
80_E	112_S	0.686	0.17
131_N	140_I	0.678	0.17
37_K	98_E	0.676	0.17
121_T	137_P	0.674	0.17
128_D	174_V	0.668	0.17
120_F	124_G	0.667	0.17
206_L	210_D	0.664	0.17
158_I	218_L	0.664	0.17
93_R	203_R	0.663	0.17
62_H	191_Y	0.663	0.17
141_E	164_D	0.661	0.17
91_A	96_P	0.661	0.17
48_P	117_E	0.657	0.17
90_V	99_V	0.657	0.17
148_T	153_T	0.656	0.17
45_S	160_L	0.654	0.17
127_I	133_I	0.652	0.16
153_T	157_K	0.650	0.16
83_N	88_K	0.649	0.16
60_I	90_V	0.649	0.16
84_D	166_K	0.649	0.16
53_L	103_D	0.648	0.16
71_N	117_E	0.647	0.16
142_E	201_K	0.647	0.16
116_K	222_L	0.645	0.16
86_P	97_K	0.645	0.16
44_A	185_S	0.638	0.16
46_E	102_I	0.638	0.16
37_K	202_I	0.636	0.16
99_V	103_D	0.635	0.16
37_K	131_N	0.634	0.16
57_G	74_P	0.630	0.16
168_N	180_Q	0.627	0.16
142_E	152_N	0.624	0.16
75_P	172_I	0.620	0.16
37_K	95_R	0.618	0.16
34_V	52_I	0.618	0.16
127_I	158_I	0.618	0.16
48_P	98_E	0.616	0.15
37_K	101_E	0.613	0.15
145_V	180_Q	0.613	0.15
114_E	152_N	0.610	0.15
76_G	181_L	0.608	0.15
163_L	169_F	0.608	0.15
68_E	116_K	0.608	0.15
68_E	222_L	0.602	0.15
37_K	169_F	0.602	0.15
28_I	169_F	0.600	0.15
138_S	145_V	0.599	0.15
52_I	145_V	0.599	0.15
83_N	103_D	0.598	0.15
145_V	168_N	0.596	0.15
93_R	180_Q	0.595	0.15
122_I	130_V	0.595	0.15
62_H	177_S	0.594	0.15
65_V	93_R	0.590	0.15
121_T	225_E	0.590	0.15
124_G	158_I	0.589	0.15
44_A	61_I	0.588	0.15
28_I	79_I	0.588	0.15
98_E	162_G	0.587	0.15
57_G	215_A	0.587	0.15
153_T	218_L	0.587	0.15
152_N	217_E	0.586	0.15
139_M	229_Y	0.581	0.15
36_Y	39_R	0.580	0.15
164_D	168_N	0.580	0.15
50_L	55_P	0.580	0.15
191_Y	219_L	0.579	0.15
37_K	233_N	0.574	0.14
89_I	220_Q	0.573	0.14
99_V	107_V	0.572	0.14
179_A	183_A	0.572	0.14
86_P	94_N	0.571	0.14
103_D	145_V	0.570	0.14
85_Y	203_R	0.570	0.14
154_P	158_I	0.569	0.14
60_I	120_F	0.568	0.14
31_T	108_F	0.568	0.14
131_N	180_Q	0.565	0.14
27_V	95_R	0.564	0.14
195_R	229_Y	0.562	0.14
136_N	162_G	0.560	0.14
144_F	225_E	0.559	0.14
30_A	87_L	0.559	0.14
53_L	145_V	0.556	0.14
77_T	145_V	0.552	0.14
82_M	192_L	0.552	0.14
33_K	160_L	0.550	0.14
206_L	212_T	0.549	0.14
53_L	59_V	0.548	0.14
88_K	111_T	0.546	0.14
107_V	171_I	0.544	0.14
212_T	224_L	0.542	0.14
113_A	213_I	0.541	0.14
71_N	218_L	0.538	0.14
157_K	214_H	0.538	0.14
122_I	125_R	0.538	0.14
68_E	119_D	0.537	0.14
32_C	49_R	0.536	0.13
90_V	180_Q	0.536	0.13
90_V	94_N	0.535	0.13
34_V	120_F	0.533	0.13
55_P	133_I	0.533	0.13
100_I	210_D	0.532	0.13
205_I	227_I	0.532	0.13
133_I	146_P	0.531	0.13
97_K	136_N	0.529	0.13
162_G	202_I	0.528	0.13
66_K	182_N	0.527	0.13
76_G	214_H	0.527	0.13
66_K	139_M	0.521	0.13
143_G	165_K	0.521	0.13
111_T	142_E	0.519	0.13
172_I	207_V	0.518	0.13
28_I	42_S	0.518	0.13
119_D	216_R	0.517	0.13
127_I	154_P	0.516	0.13
87_L	107_V	0.514	0.13
177_S	218_L	0.512	0.13
61_I	101_E	0.509	0.13
31_T	46_E	0.507	0.13
115_V	223_G	0.505	0.13
194_M	223_G	0.505	0.13
153_T	214_H	0.504	0.13
42_S	71_N	0.502	0.13
41_E	128_D	0.501	0.13
51_I	163_L	0.501	0.13
147_L	193_H	0.501	0.13
86_P	145_V	0.500	0.13

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2vldA	2	0.9492	100	0.276	Contact Map
1y88A	5	0.4407	96.9	0.923	Contact Map
2wcwA	2	0.4068	96	0.931	Contact Map
3h1tA	1	0.4025	94.9	0.936	Contact Map
1gefA	2	0.4237	92.2	0.942	Contact Map
2eo0A	2	0.428	91.8	0.943	Contact Map
1ob8A	1	0.3898	88.5	0.947	Contact Map
4f0qA	4	0.9237	88.4	0.947	Contact Map
1hh1A	2	0.4068	87.6	0.948	Contact Map
3fovA	2	0.3771	87.3	0.948	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0085 seconds.