Q97WJ9 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97WJ9 - Uncharacterized protein

UniProt:	Q97WJ9	Sequences: MHIIFDTSGFLSGLQLSLDRVYTTQEVINEIKDKYSRFNLEIAISSGKVIIMKPSTRSVEKVTKVLNLTKERKLSNTDISVIALALDLQPSIVFTDDLSVQNILKQLGIQFSSVKINKKVEKSFKFKYVCVNCKREFNIDHGECPYCGGKVVKRRIME	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	158 (134)
Sequences:	469 (385)
Seq/√Len:	33.3

HALSA - Q9HNQ4
SULSO - Q97WJ9

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
93_V	104_L	5.956	1.00
127_K	136_E	5.014	1.00
33_D	36_S	3.090	1.00
74_L	78_D	2.735	1.00
135_R	146_Y	2.559	1.00
108_G	117_N	2.486	1.00
108_G	123_S	2.387	0.99
75_S	78_D	2.297	0.99
93_V	117_N	2.150	0.99
136_E	155_R	2.099	0.98
100_V	128_Y	1.992	0.98
95_T	100_V	1.983	0.98
26_E	80_S	1.895	0.97
73_K	78_D	1.881	0.97
98_L	121_E	1.863	0.97
117_N	149_G	1.734	0.95
98_L	126_F	1.732	0.95
111_F	119_K	1.680	0.94
84_L	88_L	1.647	0.93
127_K	156_I	1.629	0.93
65_V	89_Q	1.619	0.93
144_C	147_C	1.542	0.91
113_S	126_F	1.529	0.91
143_E	152_V	1.499	0.90
44_I	48_K	1.425	0.87
40_L	43_A	1.422	0.87
125_K	134_K	1.412	0.87
79_I	83_A	1.412	0.87
126_F	155_R	1.406	0.86
142_G	154_R	1.367	0.85
94_F	125_K	1.348	0.84
126_F	156_I	1.343	0.84
36_S	66_L	1.342	0.84
73_K	99_S	1.321	0.83
126_F	153_K	1.313	0.82
93_V	149_G	1.312	0.82
59_V	79_I	1.311	0.82
113_S	137_F	1.310	0.82
104_L	125_K	1.290	0.81
96_D	114_V	1.283	0.81
32_K	37_R	1.268	0.80
24_T	80_S	1.268	0.80
137_F	145_P	1.268	0.80
104_L	132_N	1.242	0.79
129_V	134_K	1.241	0.79
94_F	122_K	1.236	0.78
106_Q	132_N	1.203	0.76
105_K	111_F	1.189	0.76
85_A	93_V	1.187	0.75
94_F	104_L	1.173	0.75
138_N	156_I	1.155	0.73
77_T	80_S	1.153	0.73
114_V	123_S	1.135	0.72
52_M	91_S	1.095	0.69
110_Q	125_K	1.089	0.69
144_C	148_G	1.087	0.69
43_A	53_K	1.086	0.69
132_N	139_I	1.065	0.67
126_F	141_H	1.063	0.67
88_L	91_S	1.060	0.67
27_V	31_I	1.047	0.66
64_K	81_V	1.039	0.65
125_K	131_V	1.035	0.65
66_L	69_T	1.030	0.64
66_L	70_K	1.023	0.64
137_F	152_V	1.003	0.62
30_E	66_L	0.994	0.62
131_V	152_V	0.984	0.61
92_I	109_I	0.982	0.61
122_K	150_K	0.972	0.60
108_G	118_K	0.965	0.59
96_D	122_K	0.955	0.59
119_K	129_V	0.952	0.58
143_E	151_V	0.942	0.57
78_D	83_A	0.941	0.57
122_K	137_F	0.940	0.57
131_V	149_G	0.939	0.57
138_N	142_G	0.930	0.56
113_S	122_K	0.929	0.56
53_K	71_E	0.927	0.56
85_A	88_L	0.917	0.55
129_V	151_V	0.902	0.54
104_L	140_D	0.892	0.53
31_I	54_P	0.886	0.53
74_L	83_A	0.878	0.52
94_F	118_K	0.870	0.51
124_F	153_K	0.862	0.51
48_K	111_F	0.858	0.50
70_K	75_S	0.856	0.50
65_V	68_L	0.855	0.50
135_R	145_P	0.846	0.49
103_I	111_F	0.845	0.49
38_F	42_I	0.844	0.49
49_V	59_V	0.843	0.49
118_K	149_G	0.836	0.49
65_V	71_E	0.823	0.48
92_I	96_D	0.820	0.47
31_I	44_I	0.818	0.47
100_V	114_V	0.810	0.46
132_N	149_G	0.807	0.46
136_E	153_K	0.801	0.46
105_K	128_Y	0.798	0.45
113_S	142_G	0.798	0.45
108_G	141_H	0.798	0.45
111_F	114_V	0.790	0.45
24_T	58_S	0.789	0.45
96_D	115_K	0.788	0.45
106_Q	131_V	0.785	0.44
114_V	131_V	0.779	0.44
104_L	113_S	0.769	0.43
100_V	110_Q	0.765	0.43
35_Y	39_N	0.762	0.43
107_L	150_K	0.754	0.42
137_F	146_Y	0.752	0.42
98_L	115_K	0.749	0.41
134_K	143_E	0.746	0.41
127_K	155_R	0.744	0.41
95_T	111_F	0.744	0.41
92_I	134_K	0.738	0.41
49_V	55_S	0.737	0.40
99_S	131_V	0.734	0.40
124_F	142_G	0.731	0.40
146_Y	150_K	0.725	0.40
63_T	76_N	0.725	0.40
69_T	78_D	0.722	0.39
106_Q	123_S	0.718	0.39
21_V	73_K	0.709	0.38
62_V	65_V	0.707	0.38
94_F	149_G	0.704	0.38
94_F	121_E	0.700	0.38
110_Q	123_S	0.699	0.37
27_V	30_E	0.696	0.37
105_K	131_V	0.696	0.37
93_V	118_K	0.690	0.37
105_K	119_K	0.687	0.37
53_K	57_R	0.686	0.36
30_E	54_P	0.680	0.36
106_Q	117_N	0.666	0.35
70_K	84_L	0.666	0.35
41_E	48_K	0.664	0.35
109_I	128_Y	0.664	0.35
101_Q	113_S	0.657	0.34
32_K	54_P	0.656	0.34
98_L	120_V	0.654	0.34
75_S	81_V	0.654	0.34
92_I	119_K	0.653	0.34
98_L	101_Q	0.652	0.34
31_I	47_G	0.650	0.34
74_L	81_V	0.649	0.34
80_S	83_A	0.643	0.33
142_G	149_G	0.642	0.33
55_S	87_D	0.631	0.32
31_I	36_S	0.621	0.32
97_D	133_C	0.620	0.32
127_K	137_F	0.619	0.31
69_T	86_L	0.618	0.31
142_G	150_K	0.613	0.31
96_D	126_F	0.605	0.30
62_V	69_T	0.603	0.30
99_S	124_F	0.602	0.30
25_Q	31_I	0.601	0.30
69_T	74_L	0.600	0.30
54_P	62_V	0.592	0.30
114_V	150_K	0.586	0.29
72_R	77_T	0.586	0.29
94_F	107_L	0.585	0.29
34_K	51_I	0.580	0.29
70_K	88_L	0.578	0.29
128_Y	152_V	0.578	0.29
36_S	44_I	0.564	0.28
74_L	77_T	0.560	0.27
103_I	106_Q	0.559	0.27
110_Q	153_K	0.558	0.27
142_G	155_R	0.558	0.27
105_K	118_K	0.556	0.27
107_L	135_R	0.555	0.27
92_I	127_K	0.550	0.27
36_S	62_V	0.550	0.27
111_F	141_H	0.548	0.27
70_K	78_D	0.548	0.27
104_L	115_K	0.544	0.26
78_D	81_V	0.544	0.26
146_Y	149_G	0.542	0.26
69_T	83_A	0.541	0.26
100_V	103_I	0.540	0.26
24_T	27_V	0.537	0.26
136_E	150_K	0.537	0.26
112_S	142_G	0.535	0.26
78_D	82_I	0.533	0.26
106_Q	110_Q	0.530	0.25
47_G	57_R	0.528	0.25
77_T	83_A	0.527	0.25
120_V	132_N	0.522	0.25
30_E	70_K	0.519	0.25
96_D	121_E	0.517	0.25
139_I	155_R	0.515	0.24
133_C	144_C	0.509	0.24
133_C	147_C	0.509	0.24
33_D	37_R	0.508	0.24
106_Q	155_R	0.501	0.24
69_T	75_S	0.500	0.24

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2lcqA	1	0.9557	100	0.503	Contact Map
2conA	1	0.2911	99.7	0.672	Contact Map
3ix7A	2	0.7025	98.3	0.83	Contact Map
3i8oA	2	0.7722	97.9	0.846	Contact Map
2kdxA	1	0.6392	96.6	0.878	Contact Map
2dokA	2	0.7278	96.4	0.881	Contact Map
1o4wA	2	0.7025	95.7	0.888	Contact Map
2fe1A	2	0.6519	93.7	0.899	Contact Map
4qiwP	1	0.1835	92.7	0.902	Contact Map
2apoB	1	0.2089	90.4	0.908	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0067 seconds.