Q97WJ3 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97WJ3 - Uncharacterized protein

UniProt:	Q97WJ3	Sequences: MIAIDKVKIKGHHNVRAFHKTTLEITKDDYLTSRGDCIIGILANKGARDLSEDLKKIARNDKSFIYGVIRVKEFLDVVHGRGSSKFTFENQNKIIFRKSTFIEGSTVMINSDKAARDINREIIDLLKTEIEGEIIILASDQPLEDKEILRIVVNLNPRSST	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	161 (134)
Sequences:	184 (131)
Seq/√Len:	11.3

HALSA - Q9HS57
SULSO - Q97WJ3

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
80_G	108_M	3.709	0.99
95_I	105_S	3.412	0.98
31_L	35_G	3.336	0.97
93_K	103_E	3.118	0.96
23_L	69_I	2.732	0.92
93_K	105_S	2.656	0.90
30_Y	41_I	2.600	0.89
76_D	113_K	2.288	0.82
5_D	45_K	2.258	0.81
118_I	122_I	2.210	0.80
114_A	117_D	2.137	0.77
9_I	28_D	2.064	0.75
47_A	50_L	1.985	0.72
78_V	112_D	1.940	0.70
71_V	122_I	1.925	0.69
27_K	46_G	1.889	0.68
32_T	35_G	1.874	0.67
95_I	103_E	1.860	0.66
47_A	107_V	1.854	0.66
90_N	104_G	1.781	0.63
69_I	132_G	1.772	0.62
70_R	73_E	1.769	0.62
83_S	109_I	1.728	0.60
87_T	102_I	1.657	0.57
10_K	42_L	1.634	0.56
96_F	118_I	1.612	0.55
7_V	43_A	1.573	0.53
19_H	82_G	1.566	0.53
90_N	93_K	1.556	0.52
28_D	92_N	1.544	0.52
25_I	104_G	1.532	0.51
55_K	88_F	1.524	0.51
90_N	103_E	1.478	0.48
93_K	101_F	1.459	0.47
70_R	75_L	1.427	0.46
5_D	80_G	1.425	0.46
67_G	136_I	1.419	0.46
46_G	90_N	1.416	0.45
94_I	136_I	1.411	0.45
87_T	104_G	1.394	0.44
129_E	132_G	1.341	0.42
9_I	40_G	1.340	0.42
67_G	80_G	1.329	0.41
7_V	44_N	1.321	0.41
92_N	103_E	1.295	0.40
39_I	118_I	1.274	0.39
13_H	100_T	1.253	0.38
72_K	132_G	1.251	0.38
25_I	89_E	1.188	0.35
27_K	113_K	1.141	0.33
79_H	112_D	1.129	0.32
44_N	54_L	1.117	0.32
67_G	134_I	1.116	0.32
56_K	100_T	1.092	0.31
67_G	113_K	1.081	0.30
76_D	119_N	1.070	0.30
82_G	86_F	1.068	0.30
96_F	107_V	1.067	0.30
21_T	93_K	1.048	0.29
7_V	53_D	1.047	0.29
27_K	94_I	1.045	0.29
122_I	135_I	1.042	0.29
28_D	96_F	1.035	0.28
28_D	65_I	1.005	0.27
113_K	117_D	1.003	0.27
28_D	58_A	0.986	0.26
14_N	80_G	0.985	0.26
39_I	78_V	0.984	0.26
71_V	118_I	0.983	0.26
40_G	69_I	0.982	0.26
23_L	41_I	0.976	0.26
41_I	64_F	0.962	0.26
66_Y	95_I	0.959	0.25
102_I	109_I	0.952	0.25
71_V	91_Q	0.947	0.25
19_H	86_F	0.944	0.25
69_I	118_I	0.932	0.24
45_K	51_S	0.932	0.24
15_V	29_D	0.928	0.24
113_K	118_I	0.927	0.24
65_I	80_G	0.925	0.24
27_K	49_D	0.897	0.23
124_D	130_I	0.878	0.23
68_V	75_L	0.877	0.23
71_V	74_F	0.874	0.22
96_F	108_M	0.874	0.22
129_E	133_E	0.862	0.22
119_N	135_I	0.852	0.22
111_S	115_A	0.849	0.22
59_R	78_V	0.846	0.21
61_D	112_D	0.844	0.21
58_A	65_I	0.839	0.21
71_V	78_V	0.838	0.21
30_Y	101_F	0.834	0.21
65_I	88_F	0.834	0.21
5_D	54_L	0.825	0.21
72_K	102_I	0.817	0.21
23_L	96_F	0.815	0.20
70_R	123_I	0.808	0.20
5_D	105_S	0.807	0.20
57_I	114_A	0.804	0.20
57_I	111_S	0.785	0.20
15_V	53_D	0.783	0.19
21_T	54_L	0.781	0.19
79_H	134_I	0.779	0.19
49_D	87_T	0.778	0.19
87_T	136_I	0.777	0.19
23_L	88_F	0.767	0.19
19_H	41_I	0.765	0.19
36_D	117_D	0.763	0.19
17_A	111_S	0.757	0.19
18_F	89_E	0.751	0.19
73_E	91_Q	0.746	0.18
107_V	132_G	0.745	0.18
122_I	134_I	0.734	0.18
5_D	51_S	0.732	0.18
26_T	109_I	0.727	0.18
46_G	67_G	0.727	0.18
112_D	116_R	0.717	0.18
36_D	114_A	0.717	0.18
67_G	108_M	0.708	0.17
59_R	87_T	0.703	0.17
88_F	104_G	0.696	0.17
25_I	47_A	0.694	0.17
39_I	42_L	0.690	0.17
9_I	133_E	0.685	0.17
25_I	60_N	0.677	0.16
28_D	42_L	0.671	0.16
108_M	119_N	0.665	0.16
34_R	127_K	0.664	0.16
52_E	56_K	0.662	0.16
21_T	91_Q	0.659	0.16
34_R	110_N	0.658	0.16
54_L	65_I	0.647	0.16
107_V	128_T	0.646	0.16
7_V	86_F	0.643	0.16
78_V	135_I	0.642	0.16
52_E	118_I	0.635	0.15
52_E	107_V	0.631	0.15
82_G	88_F	0.630	0.15
67_G	96_F	0.630	0.15
80_G	96_F	0.630	0.15
31_L	126_L	0.621	0.15
23_L	90_N	0.619	0.15
34_R	59_R	0.619	0.15
20_K	113_K	0.613	0.15
19_H	55_K	0.611	0.15
40_G	117_D	0.609	0.15
44_N	51_S	0.606	0.15
48_R	63_S	0.604	0.15
61_D	64_F	0.601	0.15
83_S	89_E	0.596	0.14
17_A	123_I	0.592	0.14
76_D	102_I	0.592	0.14
80_G	129_E	0.585	0.14
20_K	50_L	0.584	0.14
128_T	132_G	0.581	0.14
28_D	118_I	0.580	0.14
76_D	122_I	0.580	0.14
28_D	116_R	0.578	0.14
41_I	82_G	0.576	0.14
29_D	41_I	0.572	0.14
41_I	75_L	0.568	0.14
73_E	78_V	0.567	0.14
58_A	88_F	0.564	0.14
4_I	62_K	0.560	0.14
88_F	102_I	0.553	0.13
46_G	134_I	0.551	0.13
6_K	133_E	0.546	0.13
50_L	130_I	0.546	0.13
20_K	48_R	0.544	0.13
33_S	115_A	0.543	0.13
46_G	50_L	0.541	0.13
68_V	94_I	0.538	0.13
10_K	72_K	0.537	0.13
44_N	125_L	0.537	0.13
56_K	96_F	0.537	0.13
30_Y	90_N	0.537	0.13
30_Y	35_G	0.536	0.13
57_I	101_F	0.536	0.13
130_I	135_I	0.534	0.13
88_F	91_Q	0.534	0.13
19_H	88_F	0.534	0.13
68_V	71_V	0.532	0.13
49_D	100_T	0.530	0.13
61_D	84_S	0.529	0.13
129_E	136_I	0.528	0.13
58_A	109_I	0.527	0.13
47_A	111_S	0.527	0.13
124_D	127_K	0.524	0.13
80_G	114_A	0.521	0.13
8_K	44_N	0.519	0.13
25_I	40_G	0.517	0.13
48_R	90_N	0.516	0.13
43_A	63_S	0.516	0.13
15_V	115_A	0.513	0.13
10_K	90_N	0.512	0.12
60_N	127_K	0.512	0.12
72_K	84_S	0.511	0.12
16_R	101_F	0.507	0.12
80_G	112_D	0.500	0.12

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3cbnA	1	0.8882	100	0.207	Contact Map
3pl5A	1	0.323	36.8	0.951	Contact Map
3fysA	1	0.3354	20.3	0.957	Contact Map
2pt5A	2	0.7578	14.6	0.96	Contact Map
2rodB	1	0.1677	14.4	0.96	Contact Map
3f3fC	2	0.205	10.7	0.962	Contact Map
1mgpA	1	0.3416	10.4	0.962	Contact Map
1xgwA	1	0.4099	8.7	0.963	Contact Map
3nyiA	1	0.3478	7.1	0.965	Contact Map
3j3bC	1	0.9193	6.2	0.966	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0062 seconds.