Q97WI1 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97WI1 - Phosphoglycerate mutase, putative

UniProt:	Q97WI1	Sequences: MEKYNNYVMTIIIFIRHGQSTSNVSKILSHDTNTYPLTEEGINQAKEAGKELTKLKVEKIYTSPVLRAYQTALIIGEVLGTLPIVDQRLRERFLGELNNTSFDPNDHWKLKVFKKQIEIKGIESWEDITKRMKSFLESVINKDNRIITAVSHSDPIRAIITYLLDMDDISGWGIRIPNASFTILRCDNNIDSCRIISIGSPLLTQQILSKLDINII	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	216 (184)
Sequences:	14305 (10214)
Seq/√Len:	753.0

ECOLI - GPMB COBC GPMA SIXA
BACSU - PHOE
SULSO - Q97WI1 Q97YV8

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
88_R	138_S	2.975	1.00
64_P	90_R	2.924	1.00
42_I	70_Q	2.809	1.00
11_I	183_I	2.757	1.00
69_Y	85_V	2.746	1.00
96_E	121_G	2.710	1.00
11_I	146_I	2.475	1.00
133_K	162_Y	2.449	1.00
132_M	155_P	2.369	1.00
19_Q	40_E	2.331	1.00
88_R	134_S	2.265	1.00
59_K	84_I	2.186	1.00
88_R	135_F	2.162	1.00
151_S	155_P	2.017	1.00
11_I	185_R	1.986	1.00
89_L	135_F	1.984	1.00
46_K	74_I	1.937	1.00
15_I	48_A	1.913	1.00
36_P	70_Q	1.906	1.00
19_Q	38_T	1.876	1.00
42_I	74_I	1.817	1.00
70_Q	73_L	1.788	1.00
31_D	90_R	1.777	1.00
57_V	148_T	1.769	1.00
21_T	38_T	1.768	1.00
36_P	66_L	1.762	1.00
60_I	76_G	1.709	1.00
86_D	138_S	1.667	1.00
15_I	75_I	1.632	1.00
58_E	145_R	1.578	1.00
124_S	127_D	1.571	1.00
60_I	72_A	1.570	1.00
64_P	87_Q	1.561	1.00
69_Y	73_L	1.544	1.00
13_I	57_V	1.540	1.00
15_I	148_T	1.532	1.00
31_D	93_F	1.528	1.00
151_S	156_I	1.519	1.00
62_T	85_V	1.511	1.00
118_E	127_D	1.507	1.00
50_K	78_V	1.506	1.00
58_E	146_I	1.498	1.00
43_N	46_K	1.491	1.00
156_I	176_I	1.485	1.00
43_N	47_E	1.469	1.00
21_T	25_S	1.469	1.00
123_E	131_R	1.467	1.00
13_I	146_I	1.453	1.00
86_D	135_F	1.442	1.00
13_I	183_I	1.441	1.00
75_I	150_V	1.431	1.00
101_S	104_P	1.413	1.00
39_E	42_I	1.403	1.00
40_E	44_Q	1.377	1.00
19_Q	24_V	1.358	1.00
133_K	137_E	1.346	1.00
42_I	46_K	1.341	1.00
40_E	43_N	1.321	1.00
113_F	116_Q	1.318	1.00
108_W	112_V	1.316	1.00
45_A	71_T	1.305	1.00
100_T	104_P	1.272	1.00
22_S	35_Y	1.265	1.00
61_Y	135_F	1.258	1.00
186_C	193_C	1.247	1.00
132_M	159_I	1.241	1.00
127_D	130_K	1.202	1.00
22_S	29_S	1.198	1.00
126_E	130_K	1.198	1.00
22_S	27_I	1.188	1.00
73_L	77_E	1.187	1.00
66_L	70_Q	1.166	1.00
59_K	145_R	1.165	1.00
63_S	152_H	1.128	1.00
63_S	68_A	1.121	1.00
50_K	53_T	1.114	1.00
10_T	143_D	1.108	1.00
93_F	98_N	1.098	1.00
129_T	133_K	1.097	1.00
62_T	83_P	1.094	1.00
135_F	139_V	1.090	1.00
23_N	178_N	1.089	1.00
128_I	155_P	1.087	1.00
47_E	50_K	1.067	1.00
46_K	77_E	1.066	1.00
32_T	98_N	1.049	1.00
72_A	150_V	1.047	1.00
14_F	156_I	1.042	1.00
76_G	83_P	1.040	1.00
38_T	41_G	1.034	1.00
62_T	69_Y	1.027	1.00
61_Y	86_D	1.019	1.00
170_S	173_G	1.013	1.00
89_L	149_A	1.005	1.00
65_V	90_R	0.997	1.00
19_Q	44_Q	0.997	1.00
116_Q	126_E	0.992	1.00
14_F	159_I	0.985	1.00
138_S	142_K	0.983	1.00
72_A	83_P	0.981	1.00
59_K	147_I	0.976	1.00
68_A	152_H	0.975	1.00
57_V	146_I	0.971	1.00
64_P	85_V	0.968	1.00
73_L	83_P	0.964	1.00
87_Q	90_R	0.960	1.00
96_E	120_K	0.957	1.00
136_L	159_I	0.954	1.00
49_G	74_I	0.951	1.00
107_H	111_K	0.946	1.00
34_T	66_L	0.945	1.00
128_I	158_A	0.936	1.00
130_K	134_S	0.930	1.00
20_S	178_N	0.926	1.00
29_S	35_Y	0.925	1.00
135_F	149_A	0.914	1.00
160_I	164_L	0.912	1.00
74_I	77_E	0.911	1.00
13_I	55_L	0.911	1.00
187_D	192_S	0.905	1.00
53_T	78_V	0.896	1.00
27_I	101_S	0.895	1.00
167_D	170_S	0.890	1.00
137_E	141_N	0.890	1.00
46_K	78_V	0.884	1.00
177_P	180_S	0.878	1.00
139_V	149_A	0.878	1.00
13_I	181_F	0.878	1.00
110_L	114_K	0.877	1.00
39_E	43_N	0.875	1.00
176_I	182_T	0.874	1.00
185_R	194_R	0.874	1.00
20_S	29_S	0.869	1.00
60_I	81_T	0.867	1.00
164_L	174_I	0.866	1.00
91_E	153_S	0.864	1.00
62_T	68_A	0.862	1.00
59_K	142_K	0.856	1.00
61_Y	84_I	0.853	1.00
176_I	180_S	0.848	1.00
129_T	162_Y	0.843	1.00
48_A	179_A	0.839	1.00
128_I	132_M	0.835	1.00
188_N	191_D	0.835	1.00
111_K	114_K	0.834	1.00
31_D	64_P	0.829	1.00
55_L	146_I	0.822	1.00
35_Y	38_T	0.820	1.00
129_T	158_A	0.820	1.00
160_I	182_T	0.816	1.00
21_T	36_P	0.812	1.00
66_L	69_Y	0.805	1.00
164_L	184_L	0.796	1.00
18_G	37_L	0.790	1.00
188_N	192_S	0.789	1.00
107_H	110_L	0.779	1.00
156_I	182_T	0.758	1.00
84_I	142_K	0.756	1.00
32_T	35_Y	0.755	1.00
20_S	38_T	0.753	1.00
74_I	78_V	0.751	1.00
49_G	78_V	0.749	1.00
46_K	50_K	0.747	1.00
105_N	108_W	0.745	1.00
44_Q	178_N	0.744	1.00
61_Y	139_V	0.741	1.00
24_V	40_E	0.739	1.00
23_N	29_S	0.737	1.00
61_Y	143_D	0.735	1.00
15_I	181_F	0.733	1.00
166_M	170_S	0.731	1.00
105_N	109_K	0.730	1.00
22_S	32_T	0.729	1.00
30_H	98_N	0.728	1.00
109_K	113_F	0.728	1.00
14_F	184_L	0.728	1.00
139_V	147_I	0.722	1.00
160_I	184_L	0.721	1.00
92_R	128_I	0.712	1.00
10_T	186_C	0.710	1.00
51_E	181_F	0.707	1.00
61_Y	147_I	0.706	1.00
45_A	49_G	0.698	1.00
163_L	184_L	0.697	1.00
10_T	144_N	0.694	1.00
18_G	71_T	0.692	1.00
45_A	179_A	0.690	1.00
70_Q	74_I	0.687	1.00
21_T	24_V	0.685	1.00
140_I	186_C	0.685	1.00
94_L	98_N	0.683	1.00
62_T	72_A	0.679	1.00
31_D	65_V	0.678	1.00
10_T	145_R	0.672	1.00
161_T	166_M	0.670	1.00
137_E	140_I	0.667	1.00
12_I	136_L	0.667	1.00
32_T	93_F	0.657	1.00
60_I	79_L	0.653	1.00
20_S	23_N	0.653	1.00
32_T	99_N	0.638	1.00
48_A	181_F	0.635	1.00
46_K	49_G	0.635	1.00
109_K	112_V	0.632	1.00
56_K	146_I	0.629	1.00
108_W	111_K	0.629	1.00
57_V	79_L	0.628	1.00
161_T	171_G	0.625	1.00
125_W	158_A	0.624	1.00
115_K	119_I	0.624	1.00
187_D	191_D	0.623	1.00
15_I	150_V	0.617	1.00
115_K	118_E	0.616	1.00
14_F	149_A	0.615	1.00
36_P	42_I	0.614	1.00
60_I	148_T	0.611	1.00
37_L	45_A	0.610	1.00
133_K	159_I	0.609	1.00
161_T	168_D	0.603	1.00
76_G	79_L	0.602	1.00
65_V	68_A	0.601	1.00
41_G	44_Q	0.598	1.00
10_T	140_I	0.598	1.00
91_E	154_D	0.596	1.00
130_K	133_K	0.596	1.00
89_L	139_V	0.596	1.00
110_L	113_F	0.596	1.00
134_S	138_S	0.594	1.00
41_G	45_A	0.592	1.00
137_E	162_Y	0.591	1.00
37_L	41_G	0.591	1.00
55_L	79_L	0.586	1.00
49_G	53_T	0.582	1.00
51_E	54_K	0.581	1.00
106_D	109_K	0.581	1.00
76_G	81_T	0.580	1.00
18_G	41_G	0.580	1.00
128_I	154_D	0.579	1.00
9_M	187_D	0.577	1.00
135_F	138_S	0.577	1.00
56_K	79_L	0.571	1.00
45_A	74_I	0.570	1.00
21_T	35_Y	0.566	1.00
171_G	174_I	0.564	1.00
64_P	86_D	0.564	1.00
97_L	119_I	0.561	1.00
17_H	91_E	0.560	1.00
132_M	162_Y	0.559	1.00
20_S	35_Y	0.556	1.00
18_G	44_Q	0.547	1.00
24_V	38_T	0.539	1.00
138_S	141_N	0.539	1.00
61_Y	142_K	0.538	1.00
58_E	148_T	0.537	1.00
30_H	65_V	0.536	1.00
28_L	102_F	0.529	1.00
57_V	60_I	0.528	1.00
156_I	160_I	0.526	1.00
184_L	195_I	0.525	1.00
92_R	125_W	0.525	1.00
107_H	114_K	0.524	1.00
60_I	83_P	0.523	1.00
26_K	101_S	0.521	1.00
95_G	122_I	0.518	1.00
166_M	174_I	0.518	1.00
26_K	102_F	0.513	1.00
69_Y	83_P	0.508	1.00
159_I	163_L	0.508	1.00
26_K	103_D	0.507	1.00
71_T	179_A	0.506	1.00
157_R	161_T	0.505	1.00
16_R	67_R	0.504	1.00
22_S	99_N	0.503	1.00
18_G	179_A	0.502	1.00
29_S	178_N	0.501	1.00
108_W	114_K	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3gp3A	1	0.8843	100	0.183	Contact Map
1h2eA	1	0.9213	100	0.2	Contact Map
4pzaA	2	0.9028	100	0.201	Contact Map
3kkkA	3	0.8843	100	0.206	Contact Map
1e58A	2	0.963	100	0.206	Contact Map
4ij5A	2	0.9444	100	0.208	Contact Map
2hhjA	2	0.963	100	0.208	Contact Map
3d8hA	2	0.9028	100	0.209	Contact Map
4embA	2	0.9537	100	0.22	Contact Map
4odiA	3	0.9537	100	0.221	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0074 seconds.