Q97WH5 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97WH5 - Ferric uptake regulation protein (Fur)

UniProt:	Q97WH5	Sequences: MEVDLANLLRQRNLKVTPQRIAILKLIMRGGHYSGEQIYEELKKTEPSISLSTVYNTLETLKESGILNSFEANGITWFEINRKPHVNVFCIDSNRIIDLDIEMDNFMENLTKNGLDIKNVNIIVYADCSKLGKRVE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	136 (127)
Sequences:	6706 (4397)
Seq/√Len:	390.2

ECOLI - FUR ZUR
BACSU - PERR FUR ZUR
SULSO - Q97WH5

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
91_I	118_K	4.018	1.00
92_D	127_D	3.764	1.00
95_R	130_K	3.296	1.00
116_D	132_G	3.163	1.00
27_I	67_L	2.731	1.00
114_G	129_S	2.391	1.00
26_L	41_E	2.294	1.00
117_I	124_V	2.282	1.00
91_I	125_Y	2.184	1.00
16_V	21_I	2.183	1.00
62_K	69_S	2.036	1.00
69_S	76_T	2.018	1.00
91_I	127_D	1.948	1.00
35_G	58_L	1.943	1.00
62_K	67_L	1.854	1.00
30_G	41_E	1.811	1.00
39_Y	51_L	1.801	1.00
93_S	128_C	1.794	1.00
40_E	43_K	1.788	1.00
59_E	69_S	1.773	1.00
118_K	127_D	1.764	1.00
88_V	97_I	1.741	1.00
14_L	64_S	1.735	1.00
7_N	11_Q	1.592	1.00
86_V	120_V	1.514	1.00
25_K	29_R	1.485	1.00
23_I	57_T	1.476	1.00
90_C	93_S	1.427	1.00
22_A	45_T	1.410	1.00
97_I	115_L	1.391	1.00
24_L	61_L	1.390	1.00
34_S	37_Q	1.383	1.00
8_L	12_R	1.376	1.00
115_L	129_S	1.375	1.00
22_A	25_K	1.373	1.00
41_E	44_K	1.370	1.00
88_V	115_L	1.369	1.00
21_I	25_K	1.358	1.00
39_Y	43_K	1.357	1.00
93_S	131_L	1.345	1.00
26_L	38_I	1.341	1.00
90_C	128_C	1.305	1.00
109_N	113_N	1.280	1.00
26_L	42_L	1.239	1.00
32_H	79_E	1.184	1.00
84_P	120_V	1.183	1.00
19_Q	53_T	1.171	1.00
30_G	33_Y	1.128	1.00
32_H	87_N	1.128	1.00
116_D	127_D	1.127	1.00
128_C	131_L	1.122	1.00
26_L	30_G	1.105	1.00
8_L	11_Q	1.105	1.00
105_N	109_N	1.076	1.00
60_T	64_S	1.066	1.00
36_E	40_E	1.044	1.00
39_Y	54_V	1.036	1.00
89_F	125_Y	1.033	1.00
108_E	112_K	1.026	1.00
57_T	60_T	1.004	1.00
33_Y	77_W	1.000	1.00
61_L	66_I	0.997	1.00
31_G	41_E	0.995	1.00
127_D	132_G	0.977	1.00
42_L	49_I	0.975	1.00
115_L	126_A	0.967	1.00
85_H	98_D	0.964	1.00
33_Y	41_E	0.957	1.00
26_L	45_T	0.947	1.00
88_V	126_A	0.941	1.00
107_M	120_V	0.932	1.00
119_N	125_Y	0.931	1.00
20_R	60_T	0.926	1.00
129_S	133_K	0.921	1.00
24_L	66_I	0.912	1.00
42_L	46_E	0.911	1.00
86_V	99_L	0.908	1.00
86_V	101_I	0.907	1.00
70_F	98_D	0.906	1.00
26_L	33_Y	0.903	1.00
32_H	96_I	0.892	1.00
31_G	37_Q	0.891	1.00
14_L	60_T	0.866	1.00
66_I	80_I	0.861	1.00
91_I	119_N	0.857	1.00
23_I	38_I	0.850	1.00
19_Q	49_I	0.847	1.00
32_H	85_H	0.846	1.00
35_G	54_V	0.843	1.00
18_P	21_I	0.838	1.00
40_E	44_K	0.835	1.00
27_I	33_Y	0.824	1.00
104_D	107_M	0.819	1.00
89_F	123_I	0.818	1.00
89_F	94_N	0.803	1.00
36_E	75_I	0.803	1.00
32_H	98_D	0.800	1.00
108_E	111_T	0.798	1.00
33_Y	38_I	0.794	1.00
59_E	62_K	0.782	1.00
114_G	132_G	0.779	1.00
90_C	131_L	0.778	1.00
36_E	51_L	0.768	1.00
27_I	38_I	0.763	1.00
75_I	78_F	0.762	1.00
43_K	51_L	0.755	1.00
22_A	46_E	0.751	1.00
20_R	57_T	0.736	1.00
29_R	41_E	0.719	1.00
101_I	105_N	0.717	1.00
105_N	108_E	0.716	1.00
18_P	22_A	0.711	1.00
89_F	96_I	0.711	1.00
58_L	67_L	0.705	1.00
73_N	77_W	0.705	1.00
86_V	107_M	0.702	1.00
86_V	122_I	0.700	1.00
34_S	77_W	0.696	1.00
120_V	124_V	0.694	1.00
109_N	112_K	0.691	0.99
25_K	45_T	0.685	0.99
59_E	63_E	0.679	0.99
37_Q	40_E	0.678	0.99
121_N	125_Y	0.670	0.99
19_Q	50_S	0.670	0.99
58_L	62_K	0.663	0.99
35_G	51_L	0.662	0.99
71_E	76_T	0.660	0.99
36_E	39_Y	0.659	0.99
10_R	16_V	0.645	0.99
68_N	81_N	0.644	0.99
39_Y	49_I	0.642	0.99
70_F	123_I	0.642	0.99
38_I	67_L	0.637	0.99
16_V	24_L	0.635	0.99
32_H	50_S	0.633	0.99
94_N	97_I	0.632	0.99
100_D	113_N	0.631	0.99
53_T	57_T	0.627	0.99
87_N	98_D	0.625	0.99
23_I	61_L	0.619	0.99
24_L	28_M	0.616	0.99
26_L	29_R	0.616	0.99
29_R	45_T	0.615	0.99
9_L	24_L	0.613	0.99
27_I	34_S	0.607	0.99
86_V	124_V	0.601	0.99
111_T	132_G	0.598	0.99
23_I	26_L	0.597	0.99
9_L	16_V	0.596	0.98
130_K	133_K	0.595	0.98
35_G	75_I	0.595	0.98
24_L	80_I	0.594	0.98
106_F	111_T	0.583	0.98
120_V	125_Y	0.581	0.98
22_A	42_L	0.581	0.98
36_E	69_S	0.573	0.98
102_E	105_N	0.573	0.98
42_L	47_P	0.563	0.98
19_Q	57_T	0.561	0.98
35_G	62_K	0.559	0.98
72_A	121_N	0.557	0.98
28_M	80_I	0.553	0.98
17_T	53_T	0.550	0.97
35_G	76_T	0.549	0.97
106_F	109_N	0.547	0.97
90_C	115_L	0.547	0.97
97_I	130_K	0.544	0.97
126_A	131_L	0.544	0.97
61_L	67_L	0.544	0.97
79_E	85_H	0.543	0.97
32_H	36_E	0.543	0.97
84_P	101_I	0.542	0.97
129_S	132_G	0.537	0.97
8_L	28_M	0.536	0.97
53_T	56_N	0.532	0.97
78_F	98_D	0.531	0.97
9_L	14_L	0.530	0.97
37_Q	41_E	0.530	0.97
118_K	126_A	0.529	0.97
95_R	129_S	0.529	0.97
34_S	75_I	0.528	0.97
103_M	106_F	0.523	0.97
9_L	60_T	0.521	0.97
105_N	130_K	0.515	0.96
107_M	111_T	0.513	0.96
100_D	106_F	0.509	0.96
111_T	116_D	0.506	0.96
7_N	10_R	0.502	0.96
14_L	20_R	0.500	0.96

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2fe3A	2	0.9853	100	0.186	Contact Map
2xigA	4	1	100	0.195	Contact Map
4mtdA	2	1	100	0.2	Contact Map
3eyyA	2	0.9485	100	0.203	Contact Map
4etsA	2	1	100	0.215	Contact Map
3mwmA	2	0.8897	100	0.223	Contact Map
2w57A	2	0.9191	100	0.232	Contact Map
4lmyA	2	1	100	0.251	Contact Map
2o03A	2	0.9118	100	0.256	Contact Map
1mzbA	4	0.9338	100	0.267	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0063 seconds.