Q97WG5 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97WG5 - Peroxiredoxin, bacterioferritin comigratory protein homolog (Bcp-3)

UniProt:	Q97WG5	Sequences: MNVGEEAPDFEAESTLGKIKLSDFRGKKVILYFYPKSFTSGCTRELQRFTELYDEFKKLNAEVIGVSVDKIDTQKKFAEKYGAKFPIVADDQKTISKLYSVLNERGTSAQRVTFIIDENGKIVNILKNLKKAEEHADKSLEIIKRQNST	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	149 (140)
Sequences:	12370 (7912)
Seq/√Len:	668.6

ECOLI - AHPC BCP TPX DSBE
BACSU - BCP AHPC YKUU TPX YKUV RESA STOA YNEN
HALSA - Q9HQE6 Q9HP28 Q9HN00 Q9HRG4
SULSO - Q97WG5 Q97VL0 Q97WP9 TDXH

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
28_K	118_E	3.527	1.00
50_T	84_K	2.824	1.00
37_S	74_Q	2.748	1.00
11_E	20_K	2.542	1.00
27_K	62_E	2.522	1.00
7_A	99_Y	2.501	1.00
14_S	18_K	2.457	1.00
117_D	123_V	2.368	1.00
6_E	121_K	2.259	1.00
53_Y	57_K	2.241	1.00
15_T	78_A	2.105	1.00
103_N	110_Q	2.087	1.00
9_D	22_S	2.020	1.00
52_L	55_E	2.019	1.00
117_D	121_K	1.927	1.00
9_D	20_K	1.889	1.00
20_K	23_D	1.859	1.00
14_S	19_I	1.819	1.00
53_Y	84_K	1.753	1.00
46_L	83_A	1.721	1.00
94_T	98_L	1.713	1.00
19_I	24_F	1.713	1.00
12_A	88_V	1.692	1.00
12_A	95_I	1.666	1.00
124_N	142_I	1.626	1.00
68_V	93_K	1.617	1.00
68_V	96_S	1.564	1.00
14_S	86_P	1.550	1.00
61_A	143_I	1.460	1.00
52_L	136_A	1.457	1.00
57_K	62_E	1.444	1.00
38_F	81_Y	1.378	1.00
38_F	76_K	1.351	1.00
24_F	64_I	1.324	1.00
137_D	141_E	1.317	1.00
29_V	62_E	1.294	1.00
75_K	79_E	1.292	1.00
30_I	115_I	1.290	1.00
116_I	122_I	1.286	1.00
50_T	85_F	1.233	1.00
24_F	29_V	1.222	1.00
25_R	29_V	1.221	1.00
96_S	109_A	1.197	1.00
65_G	87_I	1.194	1.00
93_K	97_K	1.192	1.00
28_K	61_A	1.178	1.00
54_D	57_K	1.177	1.00
28_K	123_V	1.157	1.00
3_V	124_N	1.154	1.00
68_V	109_A	1.150	1.00
33_F	66_V	1.149	1.00
29_V	64_I	1.144	1.00
95_I	99_Y	1.140	1.00
47_Q	51_E	1.140	1.00
32_Y	46_L	1.095	1.00
52_L	137_D	1.094	1.00
138_K	141_E	1.086	1.00
126_L	142_I	1.072	1.00
14_S	88_V	1.072	1.00
123_V	129_L	1.070	1.00
13_E	71_I	1.068	1.00
55_E	58_K	1.066	1.00
48_R	52_L	1.064	1.00
30_I	113_T	1.052	1.00
25_R	120_G	1.051	1.00
21_L	29_V	1.044	1.00
101_V	112_V	1.043	1.00
50_T	54_D	1.042	1.00
29_V	120_G	1.040	1.00
104_E	107_T	1.033	1.00
48_R	51_E	1.031	1.00
93_K	102_L	1.002	1.00
10_F	99_Y	0.995	1.00
10_F	95_I	0.989	1.00
76_K	79_E	0.984	1.00
38_F	80_K	0.977	1.00
97_K	102_L	0.976	1.00
47_Q	50_T	0.974	1.00
112_V	127_K	0.972	1.00
115_I	142_I	0.972	1.00
16_L	75_K	0.971	1.00
44_R	133_E	0.961	1.00
30_I	61_A	0.951	1.00
6_E	25_R	0.951	1.00
62_E	86_P	0.950	1.00
72_D	76_K	0.945	1.00
28_K	60_N	0.944	1.00
7_A	122_I	0.938	1.00
22_S	25_R	0.922	1.00
71_I	89_A	0.918	1.00
32_Y	45_E	0.917	1.00
29_V	116_I	0.917	1.00
49_F	63_V	0.913	1.00
115_I	124_N	0.901	1.00
55_E	140_L	0.892	1.00
70_K	73_T	0.890	1.00
105_R	108_S	0.889	1.00
74_Q	77_F	0.889	1.00
59_L	143_I	0.882	1.00
75_K	78_A	0.879	1.00
94_T	97_K	0.862	1.00
43_T	81_Y	0.859	1.00
64_I	88_V	0.858	1.00
45_E	113_T	0.854	1.00
31_L	116_I	0.848	1.00
32_Y	85_F	0.847	1.00
134_E	137_D	0.839	1.00
110_Q	128_N	0.836	1.00
38_F	73_T	0.831	1.00
54_D	58_K	0.827	1.00
7_A	116_I	0.824	1.00
60_N	118_E	0.818	1.00
101_V	114_F	0.818	1.00
19_I	64_I	0.814	1.00
3_V	125_I	0.812	1.00
93_K	96_S	0.807	1.00
78_A	87_I	0.798	1.00
54_D	84_K	0.798	1.00
9_D	21_L	0.797	1.00
28_K	115_I	0.793	1.00
44_R	47_Q	0.788	1.00
71_I	75_K	0.788	1.00
114_F	122_I	0.780	1.00
39_T	111_R	0.772	1.00
97_K	107_T	0.769	1.00
115_I	126_L	0.764	1.00
112_V	125_I	0.764	1.00
72_D	75_K	0.760	1.00
50_T	53_Y	0.755	1.00
30_I	49_F	0.754	1.00
134_E	138_K	0.754	1.00
96_S	102_L	0.753	1.00
114_F	125_I	0.740	1.00
47_Q	81_Y	0.740	1.00
26_G	118_E	0.737	1.00
124_N	138_K	0.735	1.00
7_A	21_L	0.732	1.00
5_E	125_I	0.731	1.00
66_V	95_I	0.720	1.00
15_T	75_K	0.713	1.00
34_Y	37_S	0.709	1.00
21_L	24_F	0.706	1.00
16_L	78_A	0.703	1.00
56_F	140_L	0.698	1.00
13_E	91_D	0.695	1.00
49_F	139_S	0.691	1.00
36_K	108_S	0.687	1.00
90_D	93_K	0.685	1.00
135_H	138_K	0.674	1.00
76_K	80_K	0.674	1.00
95_I	98_L	0.671	1.00
33_F	99_Y	0.669	1.00
45_E	49_F	0.668	1.00
31_L	99_Y	0.661	1.00
110_Q	127_K	0.656	1.00
65_G	85_F	0.651	1.00
55_E	59_L	0.650	1.00
103_N	106_G	0.648	1.00
102_L	107_T	0.648	1.00
35_P	39_T	0.648	1.00
3_V	122_I	0.644	1.00
7_A	95_I	0.643	1.00
8_P	98_L	0.643	1.00
33_F	95_I	0.638	1.00
59_L	140_L	0.632	1.00
15_T	86_P	0.631	1.00
53_Y	62_E	0.629	1.00
24_F	62_E	0.625	1.00
103_N	107_T	0.621	1.00
113_T	139_S	0.617	1.00
126_L	139_S	0.613	1.00
52_L	56_F	0.610	1.00
37_S	73_T	0.607	1.00
33_F	101_V	0.606	1.00
69_D	73_T	0.600	1.00
40_S	43_T	0.597	1.00
64_I	86_P	0.594	1.00
36_K	70_K	0.593	1.00
103_N	108_S	0.593	1.00
108_S	130_K	0.592	1.00
32_Y	49_F	0.589	1.00
73_T	76_K	0.587	1.00
28_K	143_I	0.582	1.00
46_L	65_G	0.575	1.00
32_Y	113_T	0.572	1.00
13_E	18_K	0.570	1.00
34_Y	77_F	0.568	1.00
19_I	23_D	0.566	1.00
69_D	74_Q	0.564	1.00
35_P	38_F	0.561	1.00
70_K	91_D	0.558	1.00
15_T	71_I	0.555	1.00
48_R	136_A	0.553	1.00
22_S	120_G	0.550	1.00
32_Y	41_G	0.549	1.00
36_K	69_D	0.547	1.00
116_I	120_G	0.545	1.00
34_Y	65_G	0.544	1.00
36_K	39_T	0.542	1.00
49_F	136_A	0.541	1.00
9_D	25_R	0.537	1.00
6_E	9_D	0.537	1.00
56_F	61_A	0.537	1.00
30_I	139_S	0.534	1.00
57_K	84_K	0.523	0.99
30_I	143_I	0.514	0.99
46_L	85_F	0.514	0.99
10_F	21_L	0.512	0.99
110_Q	130_K	0.505	0.99
106_G	130_K	0.500	0.99

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2v2gA	2	1	100	0.206	Contact Map
1prxA	2	1	100	0.214	Contact Map
1xccA	2	1	100	0.221	Contact Map
3a2vA	5	1	100	0.222	Contact Map
3w6gA	6	1	100	0.222	Contact Map
1xiyA	1	0.9732	100	0.257	Contact Map
1xvwA	3	0.9933	100	0.263	Contact Map
3tjjA	3	1	100	0.281	Contact Map
4rqxA	3	1	100	0.289	Contact Map
2pn8A	4	1	100	0.29	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0066 seconds.