Q97WF7 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97WF7 - Methylmalonyl-CoA mutase, alpha-subunit, chain B (McmA2)

UniProt:	Q97WF7	Sequences: MMITTKRIKVIVAKLGLDGHDRGAKVVARALKDAGMEVVYTGLRQTPEQIVRAALQEDADVIGISILSGAHLELIPKVVEIMKQNGLNDVGLIVGGVIPPEDIKKLKEMGVDEVFLPGSSLKEIVEKVKKVAREKRGISVE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	141 (129)
Sequences:	1785 (706)
Seq/√Len:	62.1

ECOLI - SCPA
HALSA - Q9HRJ2
SULSO - Q97WF7

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
11_I	59_A	4.576	1.00
75_I	94_V	4.304	1.00
107_K	113_E	3.266	1.00
81_I	84_Q	2.857	1.00
104_K	108_E	2.801	1.00
61_V	93_I	2.762	1.00
115_F	127_K	2.524	1.00
79_V	92_L	2.490	1.00
12_V	24_A	2.287	1.00
72_L	105_K	2.283	1.00
52_R	56_Q	2.283	1.00
52_R	85_N	2.244	1.00
51_V	81_I	2.214	1.00
87_L	90_V	2.201	1.00
83_K	88_N	1.934	1.00
15_L	50_I	1.929	1.00
82_M	87_L	1.851	1.00
48_E	81_I	1.842	1.00
54_A	62_I	1.825	1.00
77_K	80_E	1.811	1.00
79_V	111_V	1.727	0.99
80_E	84_Q	1.713	0.99
64_I	78_V	1.678	0.99
15_L	64_I	1.630	0.99
27_V	31_L	1.605	0.99
8_I	36_M	1.555	0.99
55_L	87_L	1.547	0.99
34_A	125_V	1.545	0.99
81_I	85_N	1.496	0.98
13_A	50_I	1.461	0.98
105_K	108_E	1.461	0.98
45_Q	49_Q	1.437	0.98
91_G	112_D	1.402	0.97
54_A	90_V	1.401	0.97
39_V	57_E	1.372	0.97
122_K	126_E	1.302	0.96
126_E	130_K	1.283	0.96
107_K	114_V	1.281	0.96
105_K	109_M	1.276	0.95
9_K	39_V	1.272	0.95
79_V	83_K	1.265	0.95
9_K	37_E	1.256	0.95
103_I	116_L	1.253	0.95
37_E	57_E	1.231	0.94
31_L	124_I	1.199	0.94
51_V	85_N	1.187	0.93
55_L	85_N	1.174	0.93
91_G	131_V	1.144	0.92
41_T	45_Q	1.144	0.92
61_V	128_V	1.143	0.92
113_E	127_K	1.105	0.90
71_H	99_P	1.103	0.90
55_L	90_V	1.092	0.90
6_K	60_D	1.088	0.90
103_I	114_V	1.064	0.89
76_P	109_M	1.057	0.88
51_V	82_M	1.049	0.88
92_L	111_V	1.033	0.87
104_K	107_K	1.014	0.86
115_F	131_V	0.998	0.85
91_G	127_K	0.985	0.85
9_K	58_D	0.984	0.85
27_V	124_I	0.983	0.85
16_G	23_G	0.983	0.85
94_V	111_V	0.977	0.84
82_M	92_L	0.966	0.83
61_V	132_A	0.956	0.83
61_V	131_V	0.953	0.83
31_L	128_V	0.950	0.82
11_I	62_I	0.943	0.82
54_A	59_A	0.931	0.81
21_D	25_K	0.928	0.81
62_I	79_V	0.923	0.81
10_V	61_V	0.913	0.80
64_I	75_I	0.901	0.79
91_G	132_A	0.899	0.79
20_H	23_G	0.894	0.78
51_V	62_I	0.886	0.78
22_R	70_A	0.873	0.77
91_G	128_V	0.873	0.77
113_E	131_V	0.868	0.76
30_A	125_V	0.860	0.76
30_A	118_G	0.850	0.75
50_I	74_L	0.849	0.75
39_V	58_D	0.841	0.74
75_I	111_V	0.830	0.73
7_R	60_D	0.822	0.72
36_M	61_V	0.815	0.72
36_M	129_K	0.813	0.71
21_D	70_A	0.809	0.71
103_I	107_K	0.809	0.71
17_L	44_R	0.809	0.71
15_L	78_V	0.807	0.71
94_V	114_V	0.804	0.71
76_P	80_E	0.800	0.70
119_S	124_I	0.800	0.70
97_V	117_P	0.799	0.70
112_D	131_V	0.799	0.70
7_R	39_V	0.786	0.69
93_I	131_V	0.774	0.68
44_R	73_E	0.771	0.67
107_K	130_K	0.765	0.67
42_G	50_I	0.762	0.67
72_L	109_M	0.762	0.67
116_L	119_S	0.758	0.66
48_E	77_K	0.757	0.66
120_S	123_E	0.749	0.65
66_I	94_V	0.749	0.65
37_E	59_A	0.734	0.64
76_P	105_K	0.728	0.63
64_I	111_V	0.722	0.62
71_H	106_L	0.707	0.61
77_K	81_I	0.702	0.60
92_L	112_D	0.692	0.59
80_E	109_M	0.690	0.59
127_K	131_V	0.690	0.59
25_K	28_A	0.685	0.58
66_I	97_V	0.683	0.58
80_E	83_K	0.683	0.58
19_G	25_K	0.681	0.58
44_R	127_K	0.681	0.58
123_E	126_E	0.678	0.57
72_L	76_P	0.677	0.57
10_V	31_L	0.675	0.57
19_G	71_H	0.655	0.55
27_V	121_L	0.654	0.55
70_A	118_G	0.651	0.54
27_V	93_I	0.649	0.54
47_P	74_L	0.646	0.54
26_V	30_A	0.642	0.53
34_A	126_E	0.642	0.53
70_A	97_V	0.636	0.53
21_D	71_H	0.633	0.52
14_K	99_P	0.631	0.52
88_N	108_E	0.627	0.52
32_K	40_Y	0.620	0.51
7_R	37_E	0.619	0.51
21_D	43_L	0.619	0.51
19_G	46_T	0.617	0.51
37_E	49_Q	0.602	0.49
44_R	68_S	0.601	0.49
62_I	78_V	0.601	0.49
76_P	117_P	0.596	0.48
62_I	86_G	0.595	0.48
37_E	58_D	0.590	0.47
13_A	43_L	0.590	0.47
24_A	41_T	0.588	0.47
49_Q	90_V	0.580	0.46
97_V	116_L	0.578	0.46
88_N	91_G	0.577	0.46
128_V	132_A	0.570	0.45
32_K	39_V	0.570	0.45
61_V	91_G	0.566	0.45
39_V	53_A	0.564	0.45
83_K	112_D	0.563	0.44
42_G	57_E	0.563	0.44
79_V	103_I	0.559	0.44
12_V	41_T	0.556	0.44
79_V	109_M	0.554	0.43
83_K	111_V	0.553	0.43
32_K	57_E	0.553	0.43
130_K	133_R	0.551	0.43
126_E	129_K	0.551	0.43
36_M	132_A	0.547	0.43
27_V	63_G	0.546	0.43
46_T	49_Q	0.544	0.42
94_V	109_M	0.541	0.42
53_A	57_E	0.541	0.42
40_Y	57_E	0.540	0.42
12_V	28_A	0.540	0.42
27_V	106_L	0.536	0.41
51_V	55_L	0.535	0.41
19_G	44_R	0.532	0.41
47_P	78_V	0.531	0.41
72_L	111_V	0.528	0.41
17_L	40_Y	0.521	0.40
22_R	99_P	0.521	0.40
10_V	36_M	0.521	0.40
28_A	63_G	0.520	0.40
112_D	126_E	0.512	0.39
25_K	46_T	0.511	0.39
45_Q	125_V	0.511	0.39
108_E	133_R	0.510	0.39
22_R	25_K	0.509	0.38
48_E	52_R	0.508	0.38
42_G	53_A	0.506	0.38
41_T	50_I	0.506	0.38
43_L	73_E	0.506	0.38
41_T	44_R	0.504	0.38
14_K	19_G	0.502	0.38
48_E	85_N	0.501	0.38
7_R	52_R	0.500	0.37
65_S	95_G	0.500	0.37
97_V	114_V	0.500	0.37

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2xijA	2	0.9504	100	0.409	Contact Map
1reqA	1	0.9787	100	0.415	Contact Map
1reqB	1	0.9362	100	0.498	Contact Map
4xc8A	2	0.9858	100	0.498	Contact Map
3kp1A	2	0.9504	100	0.5	Contact Map
1xrsB	2	0.9574	99.9	0.548	Contact Map
4r3uC	1	0.9291	99.9	0.577	Contact Map
3bulA	1	0.9716	99.9	0.583	Contact Map
3ezxA	2	0.8794	99.8	0.628	Contact Map
2i2xB	1	0.9433	99.8	0.63	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0058 seconds.