Q97WF3 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97WF3 - Uncharacterized protein

UniProt:	Q97WF3	Sequences: MRVDSQMSNLSRREFSYLLTIKRYNDSGEGAKINRIAKDLKIAPSSVFEEVSHLEEKGLVKKKEDGVWITNNGTRSINYLIKAHRVIEILLVNIGIDKQTACEYSKQFDYLIPEEIIDKLYNYLGKPSYCPHGLEIPL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	138 (119)
Sequences:	2693 (1870)
Seq/√Len:	171.4

ECOLI - MNTR
BACSU - MNTR MNTC
HALSA - Q9HRU8 Q9HRV3 Q9HME7 Q9HR69
SULSO - Q97WF3 Q7LXP0

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
74_T	78_N	2.954	1.00
88_E	102_C	2.912	1.00
91_L	108_F	2.682	1.00
19_L	84_H	2.563	1.00
104_Y	113_P	2.512	1.00
100_T	115_E	2.382	1.00
82_K	121_Y	2.298	1.00
14_E	57_K	2.295	1.00
97_D	100_T	2.216	1.00
13_R	46_S	2.203	1.00
21_I	60_V	2.191	1.00
61_K	68_W	2.044	1.00
25_N	74_T	1.965	1.00
89_I	93_N	1.964	1.00
33_I	47_V	1.906	1.00
119_K	122_N	1.842	1.00
15_F	110_Y	1.841	1.00
121_Y	126_K	1.819	1.00
112_I	117_I	1.786	1.00
79_Y	114_E	1.761	1.00
92_V	98_K	1.681	1.00
19_L	106_K	1.656	1.00
23_R	81_I	1.633	1.00
49_E	53_H	1.630	1.00
42_I	47_V	1.616	1.00
51_V	60_V	1.582	1.00
59_L	72_N	1.533	1.00
71_N	74_T	1.513	1.00
87_I	112_I	1.466	1.00
72_N	75_R	1.454	1.00
122_N	126_K	1.445	1.00
55_E	62_K	1.444	1.00
107_Q	111_L	1.443	1.00
20_T	39_D	1.441	1.00
106_K	110_Y	1.397	1.00
27_S	39_D	1.395	1.00
90_L	94_I	1.375	1.00
90_L	123_Y	1.321	1.00
21_I	31_A	1.269	1.00
35_R	38_K	1.264	1.00
15_F	109_D	1.255	1.00
12_R	16_S	1.238	1.00
51_V	67_V	1.224	1.00
23_R	39_D	1.219	1.00
88_E	92_V	1.176	1.00
84_H	102_C	1.170	1.00
20_T	36_I	1.156	1.00
11_S	14_E	1.146	1.00
87_I	120_L	1.138	1.00
124_L	127_P	1.105	1.00
79_Y	83_A	1.101	1.00
114_E	118_D	1.092	1.00
25_N	31_A	1.080	1.00
82_K	86_V	1.079	1.00
106_K	109_D	1.076	1.00
46_S	50_E	1.075	1.00
22_K	81_I	1.029	0.99
17_Y	46_S	1.025	0.99
36_I	51_V	1.024	0.99
24_Y	31_A	0.962	0.99
104_Y	116_I	0.957	0.99
75_R	79_Y	0.952	0.99
16_S	106_K	0.944	0.99
92_V	101_A	0.936	0.99
97_D	115_E	0.935	0.99
15_F	80_L	0.916	0.99
40_L	50_E	0.916	0.99
14_E	50_E	0.915	0.99
36_I	67_V	0.908	0.98
44_P	50_E	0.897	0.98
115_E	119_K	0.896	0.98
18_L	22_K	0.895	0.98
25_N	29_E	0.894	0.98
30_G	66_G	0.889	0.98
22_K	77_I	0.889	0.98
54_L	59_L	0.882	0.98
48_F	62_K	0.878	0.98
85_R	88_E	0.864	0.98
18_L	76_S	0.859	0.98
94_I	119_K	0.850	0.98
96_I	104_Y	0.850	0.98
96_I	116_I	0.848	0.98
61_K	70_T	0.841	0.98
33_I	51_V	0.838	0.97
76_S	79_Y	0.820	0.97
105_S	111_L	0.816	0.97
60_V	67_V	0.816	0.97
19_L	109_D	0.809	0.97
25_N	30_G	0.808	0.97
26_D	85_R	0.806	0.97
83_A	117_I	0.805	0.97
100_T	104_Y	0.787	0.96
84_H	106_K	0.786	0.96
10_L	14_E	0.781	0.96
22_K	26_D	0.773	0.96
87_I	116_I	0.770	0.96
101_A	106_K	0.765	0.96
34_N	44_P	0.760	0.96
19_L	23_R	0.754	0.95
16_S	19_L	0.754	0.95
58_G	72_N	0.753	0.95
83_A	114_E	0.747	0.95
16_S	111_L	0.743	0.95
28_G	35_R	0.740	0.95
84_H	88_E	0.739	0.95
33_I	44_P	0.736	0.95
33_I	48_F	0.727	0.94
52_S	55_E	0.726	0.94
90_L	124_L	0.722	0.94
71_N	75_R	0.718	0.94
104_Y	107_Q	0.716	0.94
16_S	110_Y	0.714	0.94
36_I	47_V	0.709	0.94
20_T	23_R	0.708	0.93
50_E	53_H	0.704	0.93
11_S	64_E	0.697	0.93
17_Y	47_V	0.689	0.93
43_A	49_E	0.687	0.92
112_I	116_I	0.682	0.92
104_Y	112_I	0.673	0.92
42_I	46_S	0.668	0.91
88_E	98_K	0.659	0.91
19_L	89_I	0.659	0.91
30_G	68_W	0.658	0.91
118_D	121_Y	0.648	0.90
72_N	76_S	0.646	0.90
104_Y	111_L	0.644	0.90
37_A	42_I	0.643	0.90
32_K	35_R	0.639	0.89
37_A	46_S	0.636	0.89
14_E	53_H	0.634	0.89
33_I	62_K	0.634	0.89
14_E	52_S	0.633	0.89
16_S	109_D	0.630	0.89
10_L	57_K	0.622	0.88
20_T	40_L	0.619	0.88
21_I	47_V	0.617	0.88
96_I	100_T	0.616	0.88
12_R	107_Q	0.615	0.88
95_G	119_K	0.608	0.87
43_A	48_F	0.604	0.87
14_E	80_L	0.600	0.86
84_H	109_D	0.596	0.86
52_S	56_E	0.591	0.85
49_E	52_S	0.582	0.85
22_K	74_T	0.578	0.84
47_V	51_V	0.575	0.84
22_K	78_N	0.574	0.84
117_I	121_Y	0.572	0.84
83_A	113_P	0.572	0.84
19_L	81_I	0.571	0.84
51_V	62_K	0.567	0.83
81_I	85_R	0.565	0.83
80_L	83_A	0.565	0.83
93_N	124_L	0.560	0.82
118_D	122_N	0.558	0.82
42_I	50_E	0.554	0.82
48_F	64_E	0.547	0.81
45_S	48_F	0.545	0.81
13_R	16_S	0.544	0.80
78_N	82_K	0.541	0.80
90_L	120_L	0.541	0.80
52_S	62_K	0.540	0.80
35_R	39_D	0.539	0.80
86_V	124_L	0.538	0.80
40_L	44_P	0.535	0.79
86_V	120_L	0.526	0.78
63_K	68_W	0.526	0.78
15_F	76_S	0.525	0.78
85_R	127_P	0.523	0.78
16_S	116_I	0.516	0.77
104_Y	119_K	0.515	0.77
12_R	31_A	0.509	0.76
113_P	116_I	0.507	0.76
81_I	88_E	0.507	0.76
77_I	105_S	0.506	0.76
24_Y	35_R	0.505	0.75
91_L	101_A	0.500	0.75

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1fx7A	4	0.9565	100	0.413	Contact Map
2qq9A	2	0.942	100	0.42	Contact Map
4o5vA	2	0.9348	99.9	0.43	Contact Map
3hrsA	2	0.9275	99.9	0.442	Contact Map
2x4hA	3	0.9493	99.9	0.533	Contact Map
1on2A	2	0.9348	99.8	0.579	Contact Map
2h09A	2	0.9058	99.7	0.622	Contact Map
2p8tA	1	0.8188	99.6	0.636	Contact Map
2fxaA	4	0.942	99	0.735	Contact Map
2nyxA	2	0.8261	98.8	0.754	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0064 seconds.