Q97WE7 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97WE7 - MutT-like protein

UniProt:	Q97WE7	Sequences: MILLLISYTIHHKSLNINFYHYFMDRPLVAVGCLIVEENKVLLVQRKNPPNAGLWAIPGGKVEYGETLEEALKREMREETGLEVAVGNIISIVQVINEGFHYVILDFECKPIGGNLRASTDAVKVEYVPFDKLNIIQTTKTTYDMLSMYFRGEKPPYFIIQISK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	164 (129)
Sequences:	4613 (3283)
Seq/√Len:	289.1

ECOLI - NUDJ NUDC NUDG MUTT
BACSU - YJHB MUTT YVCI
HALSA - Q9HR46 Q9HS29
SULSO - Q97WE7

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
77_R	83_E	4.508	1.00
45_Q	124_K	2.986	1.00
93_V	148_M	2.940	1.00
33_C	72_L	2.588	1.00
62_V	71_A	2.586	1.00
143_Y	147_S	2.506	1.00
68_L	94_Q	2.439	1.00
40_K	129_P	2.385	1.00
66_E	74_R	2.271	1.00
67_T	70_E	2.212	1.00
49_P	52_A	1.949	1.00
129_P	132_K	1.922	1.00
45_Q	123_V	1.914	1.00
89_I	92_I	1.893	1.00
42_L	127_Y	1.802	1.00
85_A	110_K	1.784	1.00
55_W	128_V	1.739	1.00
69_E	107_F	1.679	1.00
130_F	150_F	1.638	1.00
68_L	105_L	1.630	1.00
91_S	148_M	1.622	1.00
29_V	103_V	1.575	1.00
92_I	105_L	1.554	1.00
70_E	73_K	1.516	1.00
76_M	84_V	1.500	1.00
68_L	107_F	1.490	1.00
88_N	152_G	1.455	1.00
89_I	105_L	1.451	1.00
67_T	94_Q	1.447	1.00
75_E	79_E	1.425	1.00
35_I	76_M	1.424	1.00
128_V	134_N	1.413	1.00
86_V	110_K	1.407	1.00
43_L	128_V	1.405	1.00
33_C	76_M	1.384	1.00
87_G	110_K	1.374	1.00
62_V	68_L	1.346	1.00
47_K	123_V	1.341	1.00
36_V	108_E	1.336	1.00
75_E	78_E	1.335	1.00
31_V	71_A	1.334	1.00
95_V	144_D	1.293	1.00
44_V	122_A	1.277	1.00
37_E	40_K	1.266	1.00
51_N	54_L	1.262	1.00
33_C	109_C	1.219	1.00
36_V	149_Y	1.218	1.00
45_Q	55_W	1.208	1.00
111_P	114_G	1.206	1.00
29_V	62_V	1.200	1.00
53_G	123_V	1.194	1.00
25_D	64_Y	1.187	1.00
82_L	111_P	1.185	1.00
44_V	125_V	1.174	1.00
55_W	126_E	1.162	1.00
90_I	152_G	1.147	1.00
144_D	148_M	1.130	1.00
118_A	121_D	1.123	1.00
67_T	95_V	1.117	1.00
41_V	146_L	1.115	1.00
73_K	77_R	1.109	1.00
88_N	108_E	1.101	1.00
27_P	64_Y	1.088	1.00
118_A	125_V	1.081	1.00
118_A	122_A	1.079	1.00
85_A	112_I	1.072	1.00
32_G	104_I	1.068	1.00
34_L	149_Y	1.053	1.00
119_S	122_A	1.031	1.00
73_K	84_V	1.022	1.00
46_R	50_P	1.013	1.00
81_G	117_R	0.988	1.00
147_S	151_R	0.980	1.00
75_E	121_D	0.974	1.00
66_E	71_A	0.972	1.00
32_G	106_D	0.956	1.00
44_V	56_A	0.954	1.00
73_K	87_G	0.941	1.00
60_G	75_E	0.932	1.00
30_A	102_Y	0.919	1.00
25_D	28_L	0.912	1.00
144_D	147_S	0.903	1.00
40_K	127_Y	0.903	1.00
65_G	101_H	0.902	1.00
30_A	104_I	0.894	1.00
29_V	105_L	0.888	1.00
32_G	59_G	0.882	1.00
28_L	61_K	0.880	1.00
50_P	53_G	0.880	1.00
24_M	61_K	0.875	1.00
28_L	100_F	0.854	1.00
77_R	81_G	0.852	1.00
106_D	145_M	0.828	1.00
45_Q	53_G	0.827	1.00
64_Y	101_H	0.825	1.00
60_G	79_E	0.821	1.00
61_K	102_Y	0.819	1.00
34_L	41_V	0.816	1.00
32_G	142_T	0.815	1.00
104_I	142_T	0.815	1.00
98_E	141_T	0.814	1.00
43_L	138_T	0.811	1.00
46_R	56_A	0.805	0.99
68_L	92_I	0.804	0.99
74_R	78_E	0.794	0.99
122_A	125_V	0.789	0.99
143_Y	146_L	0.781	0.99
69_E	94_Q	0.777	0.99
54_L	139_T	0.776	0.99
55_W	124_K	0.776	0.99
24_M	27_P	0.772	0.99
36_V	110_K	0.769	0.99
90_I	108_E	0.768	0.99
88_N	110_K	0.760	0.99
44_V	58_P	0.745	0.99
28_L	102_Y	0.737	0.99
86_V	109_C	0.732	0.99
39_N	130_F	0.727	0.99
32_G	61_K	0.712	0.99
89_I	107_F	0.710	0.99
54_L	135_I	0.710	0.99
51_N	139_T	0.698	0.99
39_N	129_P	0.698	0.99
139_T	142_T	0.695	0.98
62_V	103_V	0.693	0.98
83_E	113_G	0.693	0.98
57_I	145_M	0.686	0.98
56_A	139_T	0.685	0.98
31_V	94_Q	0.679	0.98
117_R	120_T	0.674	0.98
79_E	121_D	0.673	0.98
23_F	26_R	0.672	0.98
84_V	109_C	0.672	0.98
67_T	96_I	0.660	0.98
71_A	74_R	0.655	0.98
73_K	86_V	0.645	0.98
148_M	151_R	0.644	0.98
147_S	150_F	0.635	0.97
47_K	52_A	0.634	0.97
31_V	105_L	0.634	0.97
96_I	101_H	0.634	0.97
37_E	113_G	0.633	0.97
142_T	145_M	0.631	0.97
126_E	132_K	0.624	0.97
33_C	84_V	0.624	0.97
71_A	75_E	0.618	0.97
26_R	29_V	0.607	0.96
73_K	83_E	0.604	0.96
46_R	53_G	0.593	0.96
146_L	149_Y	0.592	0.96
46_R	49_P	0.588	0.96
133_L	143_Y	0.582	0.96
36_V	130_F	0.571	0.95
73_K	85_A	0.567	0.95
30_A	61_K	0.564	0.95
72_L	76_M	0.564	0.95
24_M	28_L	0.562	0.95
26_R	100_F	0.557	0.94
63_E	79_E	0.557	0.94
43_L	55_W	0.552	0.94
112_I	115_N	0.549	0.94
32_G	94_Q	0.544	0.94
93_V	145_M	0.540	0.93
57_I	106_D	0.539	0.93
80_T	119_S	0.538	0.93
34_L	90_I	0.537	0.93
26_R	64_Y	0.535	0.93
76_M	86_V	0.534	0.93
37_E	127_Y	0.532	0.93
133_L	146_L	0.532	0.93
31_V	75_E	0.529	0.93
58_P	76_M	0.527	0.93
87_G	108_E	0.526	0.93
68_L	103_V	0.526	0.93
45_Q	126_E	0.521	0.92
77_R	80_T	0.519	0.92
33_C	86_V	0.517	0.92
111_P	116_L	0.516	0.92
37_E	114_G	0.516	0.92
31_V	72_L	0.513	0.92
138_T	142_T	0.512	0.92
75_E	122_A	0.510	0.91
85_A	115_N	0.509	0.91
82_L	125_V	0.509	0.91
83_E	86_V	0.509	0.91
28_L	64_Y	0.508	0.91
44_V	79_E	0.506	0.91
132_K	135_I	0.505	0.91
80_T	122_A	0.504	0.91
93_V	141_T	0.503	0.91
59_G	106_D	0.503	0.91
86_V	108_E	0.501	0.91
133_L	136_I	0.500	0.91
52_A	123_V	0.500	0.91

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3gz5A	2	0.8415	100	0.333	Contact Map
2fmlA	2	1	100	0.354	Contact Map
5bs6A	2	0.9085	100	0.375	Contact Map
2qjtB	2	0.939	100	0.409	Contact Map
3cngA	4	0.9878	100	0.42	Contact Map
1vk6A	2	0.9268	100	0.432	Contact Map
2qjoA	3	0.9329	100	0.435	Contact Map
3i9xA	2	0.8293	99.9	0.448	Contact Map
4ktbA	4	0.8354	99.9	0.457	Contact Map
3q1pA	2	0.9451	99.9	0.473	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0068 seconds.