Q97WC8 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97WC8 - Cobalamin biosynthesis precorrin-2 methyltransferase, putative (CbiL)

UniProt:	Q97WC8	Sequences: MKLYVVGLGPGDDELITLRGAKILKEVRTIFIPYSTGTNRSLAENIVKKYADNNSKLVLLGFPMAKDVSENELKKLGEKICSESEGDSAFVTLGDPTLYSTFFRIKNKLPCSIDVEIVPGVSSITACASKAMISLANSEDSISIIPASRLDTIAKASEVFETIIVLKANENIKEIADILSKKYDLIYARRCFMSDEKLVNMEREIINDKDYFSMIIALRKKR	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	222 (208)
Sequences:	9029 (5488)
Seq/√Len:	380.5

ECOLI - CYSG
BACSU - NASF SUMT
HALSA - Q9HPN3 Q9HMY4 Q9HPN0 Q9HPM0 Q9HPN2 Q9HPM9
SULSO - Q97WC8 Q97WC5 Q97W12 Q97UT5 Q97WC9 Q97WD1

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
21_A	25_K	3.746	1.00
14_E	22_K	3.435	1.00
130_K	196_E	3.210	1.00
4_Y	23_I	2.948	1.00
189_R	197_K	2.622	1.00
27_V	89_A	2.605	1.00
200_N	204_E	2.538	1.00
127_C	191_C	2.473	1.00
56_K	83_E	2.437	1.00
188_A	191_C	2.429	1.00
200_N	208_D	2.372	1.00
4_Y	87_D	2.338	1.00
190_R	195_D	2.195	1.00
6_V	89_A	2.127	1.00
201_M	204_E	2.087	1.00
14_E	19_R	2.024	1.00
19_R	116_E	1.954	1.00
154_A	181_K	1.938	1.00
123_S	166_L	1.921	1.00
176_A	180_S	1.907	1.00
131_A	186_I	1.871	1.00
4_Y	116_E	1.865	1.00
28_R	87_D	1.813	1.00
12_D	19_R	1.806	1.00
23_I	118_V	1.791	1.00
30_I	51_A	1.773	1.00
81_C	111_C	1.756	1.00
22_K	25_K	1.754	1.00
78_E	82_S	1.735	1.00
108_K	111_C	1.732	1.00
22_K	26_E	1.726	1.00
152_T	155_K	1.680	1.00
21_A	50_Y	1.669	1.00
18_L	21_A	1.668	1.00
176_A	206_I	1.646	1.00
200_N	205_I	1.619	1.00
34_Y	63_P	1.613	1.00
26_E	87_D	1.590	1.00
97_T	102_F	1.566	1.00
190_R	193_M	1.537	1.00
143_S	160_F	1.519	1.00
178_I	181_K	1.510	1.00
82_S	85_E	1.501	1.00
164_I	216_I	1.468	1.00
204_E	208_D	1.466	1.00
29_T	83_E	1.451	1.00
122_S	125_T	1.450	1.00
154_A	178_I	1.434	1.00
6_V	20_G	1.433	1.00
32_I	57_L	1.413	1.00
143_S	161_E	1.413	1.00
174_E	177_D	1.388	1.00
5_V	102_F	1.379	1.00
122_S	166_L	1.367	1.00
127_C	188_A	1.361	1.00
75_K	78_E	1.359	1.00
144_I	166_L	1.350	1.00
79_K	83_E	1.348	1.00
124_I	166_L	1.348	1.00
16_I	20_G	1.348	1.00
7_G	96_P	1.345	1.00
155_K	158_E	1.343	1.00
171_N	174_E	1.336	1.00
154_A	182_K	1.325	1.00
17_T	121_V	1.299	1.00
165_V	217_A	1.289	1.00
81_C	108_K	1.245	1.00
189_R	210_D	1.243	1.00
97_T	117_I	1.243	1.00
3_L	109_L	1.242	1.00
173_K	207_N	1.237	1.00
23_I	89_A	1.213	1.00
177_D	181_K	1.207	1.00
20_G	118_V	1.195	1.00
155_K	159_V	1.190	1.00
31_F	83_E	1.187	1.00
165_V	168_A	1.182	1.00
4_Y	118_V	1.175	1.00
154_A	158_E	1.173	1.00
172_I	205_I	1.170	1.00
19_R	118_V	1.133	1.00
68_V	71_N	1.132	1.00
106_K	115_V	1.132	1.00
130_K	192_F	1.112	1.00
84_S	111_C	1.111	1.00
81_C	84_S	1.106	1.00
176_A	202_E	1.105	1.00
126_A	192_F	1.101	1.00
187_Y	213_S	1.092	1.00
185_L	205_I	1.089	1.00
19_R	22_K	1.079	1.00
15_L	19_R	1.078	1.00
16_I	47_V	1.075	1.00
187_Y	209_K	1.072	1.00
64_M	170_E	1.071	1.00
110_P	132_M	1.066	1.00
34_Y	59_L	1.066	1.00
10_P	15_L	1.066	1.00
141_S	161_E	1.065	1.00
23_I	116_E	1.060	1.00
178_I	182_K	1.053	1.00
163_I	179_L	1.051	1.00
6_V	118_V	1.051	1.00
79_K	82_S	1.049	1.00
199_V	208_D	1.049	1.00
90_F	105_I	1.039	1.00
173_K	177_D	1.037	1.00
188_A	198_L	1.037	1.00
164_I	214_M	1.028	1.00
172_I	209_K	1.026	1.00
98_L	125_T	1.016	1.00
174_E	178_I	1.016	1.00
103_F	137_N	1.011	1.00
13_D	46_I	1.010	1.00
128_A	216_I	0.991	1.00
18_L	50_Y	0.990	1.00
77_G	81_C	0.984	1.00
133_I	186_I	0.983	1.00
84_S	113_I	0.980	1.00
31_F	60_L	0.968	1.00
150_L	174_E	0.967	1.00
51_A	55_S	0.967	1.00
25_K	50_Y	0.964	1.00
58_V	79_K	0.961	1.00
71_N	75_K	0.959	1.00
77_G	80_I	0.957	1.00
172_I	215_I	0.950	1.00
46_I	49_K	0.946	1.00
128_A	135_L	0.944	1.00
169_N	213_S	0.933	1.00
130_K	198_L	0.932	1.00
102_F	106_K	0.930	1.00
28_R	52_D	0.928	1.00
51_A	57_L	0.921	1.00
31_F	80_I	0.907	1.00
127_C	214_M	0.906	1.00
117_I	129_S	0.904	1.00
64_M	67_D	0.901	1.00
107_N	137_N	0.901	1.00
110_P	115_V	0.900	1.00
52_D	55_S	0.898	1.00
58_V	83_E	0.894	1.00
76_L	80_I	0.893	1.00
71_N	79_K	0.893	1.00
31_F	58_V	0.893	1.00
13_D	49_K	0.892	1.00
19_R	23_I	0.886	1.00
153_I	175_I	0.882	1.00
96_P	100_S	0.878	1.00
173_K	206_I	0.873	1.00
92_T	100_S	0.872	1.00
31_F	79_K	0.870	1.00
67_D	71_N	0.867	1.00
14_E	18_L	0.865	1.00
165_V	175_I	0.860	1.00
31_F	88_S	0.858	1.00
179_L	217_A	0.848	1.00
43_A	46_I	0.847	1.00
78_E	81_C	0.837	1.00
23_I	87_D	0.835	1.00
20_G	47_V	0.832	1.00
47_V	91_V	0.832	1.00
187_Y	205_I	0.831	1.00
45_N	49_K	0.824	1.00
141_S	146_P	0.818	1.00
12_D	192_F	0.817	1.00
158_E	182_K	0.808	1.00
23_I	26_E	0.804	1.00
126_A	191_C	0.801	1.00
98_L	135_L	0.800	1.00
63_P	66_K	0.799	1.00
16_I	21_A	0.798	1.00
24_L	30_I	0.796	1.00
4_Y	27_V	0.793	1.00
34_Y	64_M	0.792	1.00
96_P	117_I	0.789	1.00
4_Y	89_A	0.788	1.00
47_V	51_A	0.786	1.00
180_S	203_R	0.781	1.00
72_E	75_K	0.779	1.00
73_L	77_G	0.777	1.00
12_D	15_L	0.772	1.00
30_I	55_S	0.770	1.00
117_I	132_M	0.769	1.00
153_I	165_V	0.765	1.00
142_I	146_P	0.760	1.00
166_L	214_M	0.759	1.00
183_Y	219_R	0.759	1.00
121_V	126_A	0.759	1.00
3_L	80_I	0.749	1.00
98_L	142_I	0.748	1.00
141_S	145_I	0.737	1.00
127_C	216_I	0.736	1.00
24_L	89_A	0.735	1.00
6_V	23_I	0.735	1.00
24_L	51_A	0.729	1.00
27_V	30_I	0.722	1.00
189_R	213_S	0.718	1.00
140_D	146_P	0.717	1.00
74_K	78_E	0.715	1.00
176_A	205_I	0.713	1.00
23_I	27_V	0.709	1.00
135_L	164_I	0.704	1.00
152_T	158_E	0.699	0.99
77_G	108_K	0.698	0.99
48_K	51_A	0.695	0.99
142_I	145_I	0.691	0.99
18_L	22_K	0.691	0.99
131_A	198_L	0.690	0.99
102_F	117_I	0.686	0.99
44_E	48_K	0.680	0.99
27_V	87_D	0.675	0.99
189_R	199_V	0.675	0.99
74_K	108_K	0.669	0.99
131_A	188_A	0.668	0.99
29_T	58_V	0.667	0.99
145_I	156_A	0.660	0.99
123_S	128_A	0.658	0.99
153_I	156_A	0.658	0.99
20_G	89_A	0.657	0.99
157_S	179_L	0.655	0.99
147_A	175_I	0.653	0.99
142_I	156_A	0.652	0.99
169_N	209_K	0.648	0.99
125_T	135_L	0.640	0.99
190_R	212_F	0.638	0.99
141_S	147_A	0.637	0.99
185_L	206_I	0.636	0.99
163_I	217_A	0.635	0.99
93_L	212_F	0.634	0.99
126_A	214_M	0.632	0.99
74_K	77_G	0.632	0.99
106_K	110_P	0.631	0.99
75_K	82_S	0.629	0.99
6_V	24_L	0.625	0.99
56_K	79_K	0.620	0.99
98_L	144_I	0.620	0.99
73_L	76_L	0.620	0.99
15_L	192_F	0.616	0.99
177_D	206_I	0.616	0.99
203_R	206_I	0.616	0.99
152_T	156_A	0.615	0.99
45_N	48_K	0.613	0.99
205_I	208_D	0.611	0.99
34_Y	61_G	0.610	0.99
64_M	211_Y	0.610	0.99
75_K	79_K	0.610	0.99
206_I	209_K	0.608	0.99
97_T	106_K	0.604	0.98
145_I	165_V	0.602	0.98
172_I	176_A	0.600	0.98
149_R	152_T	0.599	0.98
140_D	147_A	0.599	0.98
92_T	101_T	0.599	0.98
136_A	142_I	0.597	0.98
76_L	79_K	0.593	0.98
156_A	160_F	0.590	0.98
140_D	145_I	0.583	0.98
32_I	59_L	0.582	0.98
5_V	105_I	0.572	0.98
190_R	210_D	0.571	0.98
73_L	104_R	0.569	0.98
109_L	115_V	0.568	0.98
8_L	43_A	0.567	0.98
59_L	68_V	0.563	0.98
199_V	209_K	0.563	0.98
188_A	216_I	0.561	0.98
157_S	183_Y	0.561	0.98
64_M	68_V	0.558	0.97
125_T	166_L	0.557	0.97
106_K	117_I	0.557	0.97
128_A	191_C	0.556	0.97
44_E	51_A	0.555	0.97
25_K	53_N	0.554	0.97
115_V	130_K	0.551	0.97
63_P	68_V	0.551	0.97
62_F	65_A	0.547	0.97
142_I	147_A	0.547	0.97
185_L	202_E	0.546	0.97
16_I	50_Y	0.544	0.97
140_D	150_L	0.541	0.97
186_I	216_I	0.539	0.97
189_R	211_Y	0.538	0.97
121_V	125_T	0.538	0.97
124_I	164_I	0.537	0.97
147_A	171_N	0.535	0.97
106_K	132_M	0.532	0.97
103_F	136_A	0.529	0.97
187_Y	215_I	0.524	0.96
10_P	192_F	0.522	0.96
180_S	206_I	0.522	0.96
157_S	182_K	0.521	0.96
187_Y	199_V	0.520	0.96
77_G	111_C	0.518	0.96
157_S	163_I	0.515	0.96
48_K	57_L	0.515	0.96
204_E	207_N	0.514	0.96
8_L	47_V	0.512	0.96
185_L	209_K	0.511	0.96
176_A	185_L	0.510	0.96
104_R	138_S	0.510	0.96
67_D	72_E	0.510	0.96
13_D	50_Y	0.509	0.96
124_I	144_I	0.509	0.96
68_V	72_E	0.508	0.96
44_E	57_L	0.508	0.96
211_Y	215_I	0.507	0.96
130_K	188_A	0.506	0.96
143_S	159_V	0.506	0.96
143_S	163_I	0.505	0.96
7_G	121_V	0.502	0.95
115_V	132_M	0.500	0.95

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2qbuA	2	0.9685	100	0.277	Contact Map
2e0nA	2	0.9865	100	0.291	Contact Map
1pjqA	2	0.9505	100	0.316	Contact Map
1s4dA	4	0.9595	100	0.32	Contact Map
2yboA	2	0.9234	100	0.32	Contact Map
3ndcA	2	0.9369	100	0.338	Contact Map
1ve2A	2	0.9054	100	0.342	Contact Map
1cbfA	2	0.9369	100	0.348	Contact Map
4e16A	2	0.9279	100	0.348	Contact Map
2zvbA	2	0.9369	100	0.364	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0081 seconds.