Q97WA4 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97WA4 - Second ORF in transposon ISC1058

UniProt:	Q97WA4	Sequences: MRNMNITFPETSDELEVIADATGISTNTGGQYIVAKWGKTRDSKFLKIEIVMDNNEFNVVNAEVTSNEVESVKTVKDLQDKGKKFYGDKTYDVNEVYKTGVEVVVPPKKNASTKRHLARRKAVREFRKLGYDRWREEKGYGVRWRVESLFSAVRRTFGESVRQVLLGK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	168 (156)
Sequences:	275 (161)
Seq/√Len:	12.9

SULSO - Q97WA4 Q97VP0 Q97UJ1 Q97YB8 Q97Y57 Q97XJ2 Q7LX34 Q97TV4 Q97US4

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
75_V	96_V	3.274	0.98
149_L	152_A	2.845	0.95
151_S	155_R	2.628	0.93
50_I	150_F	2.626	0.93
114_K	117_L	2.524	0.91
28_T	31_Q	2.493	0.90
45_F	91_Y	2.443	0.90
89_K	108_K	2.229	0.85
26_T	44_K	2.199	0.84
141_G	144_W	2.179	0.83
49_E	71_S	2.147	0.82
64_V	161_V	2.147	0.82
110_N	120_R	2.141	0.82
119_R	134_W	2.109	0.81
16_E	29_G	2.013	0.78
153_V	161_V	1.958	0.76
20_D	23_G	1.942	0.75
24_I	161_V	1.875	0.72
25_S	31_Q	1.822	0.70
27_N	44_K	1.806	0.69
42_D	46_L	1.775	0.68
30_G	108_K	1.765	0.68
140_Y	147_E	1.755	0.67
92_D	119_R	1.719	0.66
92_D	134_W	1.718	0.65
17_V	60_V	1.708	0.65
138_K	141_G	1.652	0.62
29_G	33_I	1.632	0.61
107_P	111_A	1.605	0.60
107_P	122_A	1.585	0.59
21_A	71_S	1.584	0.59
101_V	145_R	1.572	0.58
16_E	54_N	1.558	0.58
51_V	55_N	1.551	0.57
87_G	98_K	1.540	0.57
61_N	101_V	1.518	0.56
57_F	152_A	1.492	0.54
24_I	152_A	1.466	0.53
25_S	92_D	1.401	0.50
111_A	123_V	1.399	0.49
103_V	122_A	1.397	0.49
53_D	90_T	1.367	0.48
113_T	123_V	1.356	0.47
77_D	109_K	1.355	0.47
57_F	149_L	1.352	0.47
25_S	28_T	1.352	0.47
28_T	59_V	1.337	0.46
107_P	119_R	1.331	0.46
63_E	70_E	1.314	0.45
24_I	64_V	1.304	0.44
44_K	67_N	1.295	0.44
37_W	45_F	1.292	0.44
46_L	152_A	1.261	0.42
17_V	51_V	1.242	0.41
35_A	40_T	1.239	0.41
97_Y	106_P	1.221	0.40
96_V	114_K	1.207	0.40
74_T	77_D	1.194	0.39
89_K	92_D	1.182	0.38
136_E	155_R	1.170	0.38
48_I	107_P	1.164	0.37
148_S	151_S	1.162	0.37
18_I	54_N	1.159	0.37
153_V	157_F	1.155	0.37
45_F	71_S	1.150	0.37
35_A	41_R	1.135	0.36
15_L	146_V	1.114	0.35
109_K	112_S	1.111	0.35
33_I	145_R	1.108	0.35
125_E	129_L	1.104	0.35
68_E	126_F	1.098	0.34
140_Y	143_R	1.066	0.33
25_S	150_F	1.044	0.32
121_K	124_R	1.038	0.32
132_D	135_R	1.036	0.31
78_L	91_Y	1.036	0.31
152_A	161_V	1.027	0.31
57_F	126_F	1.020	0.31
157_F	162_R	1.014	0.30
70_E	73_K	1.013	0.30
130_G	134_W	1.006	0.30
65_T	163_Q	1.000	0.30
149_L	163_Q	0.999	0.30
23_G	32_Y	0.999	0.30
61_N	79_Q	0.995	0.30
119_R	123_V	0.991	0.29
114_K	141_G	0.990	0.29
21_A	32_Y	0.984	0.29
19_A	79_Q	0.982	0.29
27_N	41_R	0.980	0.29
16_E	28_T	0.976	0.29
39_K	160_S	0.971	0.29
56_E	141_G	0.960	0.28
92_D	130_G	0.959	0.28
45_F	49_E	0.941	0.27
79_Q	101_V	0.938	0.27
32_Y	49_E	0.935	0.27
143_R	147_E	0.934	0.27
74_T	109_K	0.892	0.25
113_T	124_R	0.885	0.25
18_I	86_Y	0.883	0.25
48_I	83_K	0.863	0.24
12_S	123_V	0.860	0.24
10_E	105_V	0.854	0.24
134_W	164_V	0.844	0.24
70_E	144_W	0.844	0.24
145_R	149_L	0.842	0.23
158_G	161_V	0.840	0.23
64_V	153_V	0.840	0.23
24_I	149_L	0.834	0.23
19_A	44_K	0.830	0.23
119_R	130_G	0.818	0.23
58_N	63_E	0.817	0.23
60_V	128_K	0.815	0.22
33_I	86_Y	0.815	0.22
75_V	97_Y	0.814	0.22
61_N	160_S	0.811	0.22
85_F	101_V	0.801	0.22
107_P	126_F	0.801	0.22
22_T	48_I	0.800	0.22
68_E	109_K	0.798	0.22
52_M	145_R	0.798	0.22
26_T	38_G	0.796	0.22
132_D	138_K	0.795	0.22
76_K	85_F	0.795	0.22
74_T	85_F	0.792	0.22
86_Y	117_L	0.789	0.22
88_D	91_Y	0.788	0.22
72_V	102_E	0.787	0.21
26_T	42_D	0.787	0.21
47_K	71_S	0.783	0.21
42_D	146_V	0.780	0.21
82_G	90_T	0.773	0.21
98_K	142_V	0.766	0.21
18_I	151_S	0.764	0.21
35_A	114_K	0.763	0.21
70_E	97_Y	0.763	0.21
16_E	84_K	0.761	0.21
81_K	158_G	0.755	0.20
21_A	44_K	0.754	0.20
93_V	96_V	0.753	0.20
88_D	143_R	0.750	0.20
31_Q	34_V	0.749	0.20
134_W	147_E	0.746	0.20
135_R	141_G	0.744	0.20
26_T	48_I	0.740	0.20
64_V	125_E	0.731	0.20
35_A	155_R	0.728	0.19
125_E	138_K	0.726	0.19
129_L	133_R	0.722	0.19
40_T	109_K	0.719	0.19
95_E	124_R	0.717	0.19
15_L	139_G	0.713	0.19
18_I	26_T	0.708	0.19
17_V	31_Q	0.703	0.19
82_G	104_V	0.702	0.19
90_T	164_V	0.701	0.19
91_Y	106_P	0.700	0.19
20_D	106_P	0.698	0.19
85_F	103_V	0.678	0.18
52_M	146_V	0.674	0.18
103_V	118_A	0.668	0.18
35_A	135_R	0.668	0.18
17_V	55_N	0.666	0.18
14_E	57_F	0.660	0.17
16_E	26_T	0.657	0.17
49_E	65_T	0.657	0.17
67_N	124_R	0.656	0.17
80_D	120_R	0.655	0.17
77_D	124_R	0.654	0.17
59_V	136_E	0.650	0.17
150_F	154_R	0.646	0.17
58_N	70_E	0.645	0.17
27_N	152_A	0.645	0.17
19_A	66_S	0.642	0.17
85_F	96_V	0.640	0.17
90_T	108_K	0.635	0.17
135_R	153_V	0.631	0.17
140_Y	154_R	0.631	0.17
83_K	99_T	0.628	0.16
53_D	104_V	0.627	0.16
53_D	134_W	0.625	0.16
64_V	100_G	0.625	0.16
48_I	52_M	0.623	0.16
154_R	163_Q	0.614	0.16
61_N	131_Y	0.614	0.16
125_E	128_K	0.612	0.16
24_I	115_R	0.603	0.16
143_R	154_R	0.597	0.16
44_K	68_E	0.597	0.16
25_S	37_W	0.596	0.16
149_L	157_F	0.594	0.15
12_S	136_E	0.588	0.15
28_T	92_D	0.587	0.15
10_E	14_E	0.586	0.15
28_T	37_W	0.586	0.15
37_W	150_F	0.585	0.15
65_T	71_S	0.584	0.15
90_T	120_R	0.581	0.15
17_V	138_K	0.580	0.15
51_V	67_N	0.579	0.15
74_T	108_K	0.577	0.15
14_E	65_T	0.571	0.15
21_A	78_L	0.570	0.15
11_T	14_E	0.560	0.15
62_A	153_V	0.556	0.14
51_V	57_F	0.553	0.14
82_G	101_V	0.553	0.14
72_V	160_S	0.552	0.14
48_I	70_E	0.552	0.14
21_A	47_K	0.552	0.14
43_S	89_K	0.543	0.14
62_A	69_V	0.538	0.14
94_N	110_N	0.536	0.14
81_K	164_V	0.531	0.14
17_V	53_D	0.528	0.14
104_V	125_E	0.527	0.14
16_E	150_F	0.526	0.14
34_V	67_N	0.525	0.14
21_A	45_F	0.523	0.14
69_V	95_E	0.521	0.14
99_T	130_G	0.520	0.14
37_W	131_Y	0.517	0.13
65_T	82_G	0.517	0.13
43_S	164_V	0.517	0.13
128_K	165_L	0.516	0.13
52_M	57_F	0.515	0.13
17_V	29_G	0.512	0.13
41_R	54_N	0.510	0.13
92_D	108_K	0.508	0.13
92_D	107_P	0.504	0.13
102_E	125_E	0.503	0.13
45_F	106_P	0.502	0.13
30_G	111_A	0.500	0.13

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1musA	2	0.9881	92.4	0.915	Contact Map
4fw1A	2	0.6726	10.4	0.959	Contact Map
1xccA	2	0.7798	7.8	0.961	Contact Map
1c6vA	4	0.5774	7.6	0.962	Contact Map
2qhsA	1	0.4762	6.9	0.962	Contact Map
1bcoA	1	0.7976	6.2	0.963	Contact Map
2mw1A	1	0.4643	6	0.963	Contact Map
4a17F	1	0.7024	4.6	0.966	Contact Map
3j61G	1	0.7381	4.5	0.966	Contact Map
3l3uA	2	0.625	4.4	0.966	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0068 seconds.