Q97W90 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97W90 - Transcriptional regulatory protein, AsnC family (AsnC)

UniProt:	Q97W90	Sequences: MNSSFYYLDDIDKKILNILQQDSRIPFSRLAKMLNLSEATIYVRIKRLKENGVIKGFYTEIDFDKIGLSVVAFILIKADPKKYDNILKQLVEMKEIYEIYDVTGEYYAVLKVRVPTREDLAKVLDKIGNMDGVTSTYTMLVLRSIKDKKELDL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	153 (139)
Sequences:	13692 (8801)
Seq/√Len:	746.4

ECOLI - LRP YBAO ASNC
BACSU - YWRC AZLB YUGG LRPB LRPC YEZC LRPA
HALSA - Q9HQ13 Q9HNI1 Q9HQ33 Q9HQB6 Q9HP41 Q9HQG1 Q9HNW8 Q9HP70
SULSO - Q97W90 Q7LXS6 Q7LX67 Q97XP7 LYSM Q980P3 Q97X78 Q97VN7

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
49_K	57_F	2.928	1.00
18_I	33_M	2.925	1.00
77_K	135_S	2.551	1.00
105_E	137_Y	2.469	1.00
98_E	111_K	2.455	1.00
115_P	119_D	2.275	1.00
27_F	45_I	2.261	1.00
64_D	118_E	2.083	1.00
55_K	62_D	2.049	1.00
12_D	44_R	2.030	1.00
47_R	51_N	2.004	1.00
18_I	25_I	2.000	1.00
93_M	126_K	1.897	1.00
79_D	134_T	1.883	1.00
71_V	111_K	1.851	1.00
97_Y	113_R	1.801	1.00
73_F	100_Y	1.777	1.00
25_I	33_M	1.764	1.00
55_K	60_E	1.758	1.00
11_I	36_L	1.734	1.00
93_M	123_V	1.676	1.00
46_K	50_E	1.673	1.00
18_I	21_Q	1.647	1.00
36_L	40_T	1.644	1.00
28_S	32_K	1.608	1.00
75_L	139_M	1.596	1.00
116_T	119_D	1.554	1.00
89_Q	130_M	1.533	1.00
29_R	32_K	1.490	1.00
119_D	122_K	1.485	1.00
95_E	119_D	1.472	1.00
89_Q	92_E	1.454	1.00
28_S	38_E	1.452	1.00
36_L	41_I	1.446	1.00
86_I	90_L	1.430	1.00
37_S	40_T	1.419	1.00
76_I	110_L	1.401	1.00
15_I	30_L	1.396	1.00
82_K	85_N	1.384	1.00
27_F	42_Y	1.383	1.00
24_R	57_F	1.364	1.00
34_L	41_I	1.357	1.00
87_L	91_V	1.336	1.00
77_K	105_E	1.327	1.00
74_I	112_V	1.324	1.00
84_D	88_K	1.319	1.00
122_K	125_D	1.315	1.00
10_D	14_K	1.299	1.00
29_R	33_M	1.276	1.00
25_I	30_L	1.267	1.00
75_L	106_Y	1.263	1.00
19_L	45_I	1.262	1.00
70_V	117_R	1.255	1.00
68_L	115_P	1.244	1.00
77_K	134_T	1.211	1.00
78_A	86_I	1.208	1.00
87_L	143_R	1.207	1.00
121_A	143_R	1.200	1.00
11_I	14_K	1.192	1.00
46_K	49_K	1.189	1.00
21_Q	33_M	1.175	1.00
95_E	126_K	1.167	1.00
26_P	29_R	1.144	1.00
25_I	29_R	1.131	1.00
22_D	33_M	1.112	1.00
18_I	30_L	1.109	1.00
56_G	60_E	1.105	1.00
71_V	113_R	1.097	1.00
9_D	44_R	1.084	1.00
11_I	34_L	1.075	1.00
14_K	17_N	1.045	1.00
14_K	18_I	1.039	1.00
75_L	137_Y	1.032	1.00
27_F	31_A	1.028	1.00
96_I	112_V	1.024	1.00
22_D	25_I	1.017	1.00
23_S	57_F	0.992	1.00
42_Y	46_K	0.982	1.00
114_V	119_D	0.977	1.00
87_L	108_A	0.977	1.00
85_N	89_Q	0.971	1.00
31_A	41_I	0.970	1.00
38_E	42_Y	0.964	1.00
88_K	91_V	0.962	1.00
99_I	110_L	0.957	1.00
17_N	21_Q	0.954	1.00
14_K	34_L	0.942	1.00
73_F	109_V	0.941	1.00
24_R	49_K	0.938	1.00
100_Y	111_K	0.938	1.00
102_V	109_V	0.927	1.00
114_V	120_L	0.926	1.00
114_V	123_V	0.911	1.00
112_V	123_V	0.907	1.00
73_F	111_K	0.904	1.00
62_D	65_K	0.901	1.00
8_L	13_K	0.883	1.00
88_K	92_E	0.879	1.00
27_F	38_E	0.878	1.00
63_F	113_R	0.853	1.00
31_A	36_L	0.845	1.00
48_L	53_V	0.843	1.00
69_S	116_T	0.840	1.00
73_F	141_V	0.840	1.00
28_S	42_Y	0.837	1.00
79_D	82_K	0.826	1.00
23_S	59_T	0.820	1.00
12_D	47_R	0.813	1.00
105_E	135_S	0.808	1.00
96_I	110_L	0.808	1.00
96_I	99_I	0.807	1.00
13_K	17_N	0.790	1.00
89_Q	93_M	0.789	1.00
15_I	44_R	0.784	1.00
124_L	138_T	0.779	1.00
106_Y	137_Y	0.777	1.00
100_Y	144_S	0.766	1.00
9_D	12_D	0.758	1.00
100_Y	141_V	0.757	1.00
39_A	43_V	0.748	1.00
76_I	86_I	0.747	1.00
90_L	99_I	0.747	1.00
128_G	136_T	0.746	1.00
75_L	109_V	0.745	1.00
122_K	126_K	0.742	1.00
30_L	41_I	0.739	1.00
15_I	41_I	0.738	1.00
84_D	87_L	0.733	1.00
8_L	53_V	0.725	1.00
83_Y	108_A	0.725	1.00
18_I	22_D	0.722	1.00
75_L	105_E	0.716	1.00
77_K	106_Y	0.706	1.00
68_L	113_R	0.706	1.00
30_L	45_I	0.705	1.00
68_L	95_E	0.704	1.00
85_N	88_K	0.698	1.00
72_A	120_L	0.683	1.00
95_E	123_V	0.674	1.00
74_I	136_T	0.673	1.00
87_L	145_I	0.672	1.00
53_V	65_K	0.669	1.00
103_T	140_L	0.667	1.00
118_E	121_A	0.662	1.00
74_I	110_L	0.649	1.00
43_V	47_R	0.649	1.00
10_D	13_K	0.648	1.00
85_N	132_G	0.646	1.00
16_L	48_L	0.645	1.00
79_D	132_G	0.645	1.00
71_V	141_V	0.641	1.00
101_D	108_A	0.639	1.00
118_E	122_K	0.636	1.00
86_I	108_A	0.635	1.00
95_E	115_P	0.634	1.00
31_A	38_E	0.632	1.00
15_I	45_I	0.627	1.00
93_M	130_M	0.624	1.00
117_R	140_L	0.623	1.00
39_A	42_Y	0.619	1.00
124_L	136_T	0.618	1.00
43_V	46_K	0.611	1.00
72_A	140_L	0.611	1.00
15_I	18_I	0.610	1.00
126_K	130_M	0.609	1.00
23_S	56_G	0.609	1.00
52_G	55_K	0.608	1.00
44_R	48_L	0.607	1.00
12_D	48_L	0.601	1.00
90_L	110_L	0.595	1.00
21_Q	25_I	0.594	1.00
15_I	48_L	0.591	1.00
27_F	41_I	0.586	1.00
83_Y	128_G	0.583	1.00
15_I	25_I	0.580	1.00
62_D	66_I	0.579	1.00
102_V	106_Y	0.579	1.00
71_V	144_S	0.577	1.00
76_I	133_V	0.575	1.00
61_I	66_I	0.574	1.00
123_V	127_I	0.572	1.00
119_D	123_V	0.571	1.00
71_V	100_Y	0.569	1.00
84_D	129_N	0.557	1.00
89_Q	131_D	0.556	1.00
117_R	142_L	0.551	1.00
60_E	63_F	0.548	1.00
75_L	102_V	0.546	1.00
82_K	131_D	0.544	1.00
11_I	40_T	0.543	1.00
123_V	126_K	0.543	1.00
17_N	20_Q	0.539	1.00
101_D	128_G	0.538	1.00
76_I	136_T	0.535	1.00
54_I	57_F	0.530	1.00
85_N	131_D	0.530	1.00
72_A	138_T	0.527	1.00
20_Q	58_Y	0.526	1.00
47_R	50_E	0.524	1.00
99_I	145_I	0.520	1.00
101_D	142_L	0.516	1.00
89_Q	132_G	0.515	1.00
102_V	141_V	0.514	1.00
22_D	29_R	0.514	1.00
28_S	31_A	0.512	1.00
128_G	135_S	0.511	1.00
102_V	139_M	0.510	1.00
80_P	134_T	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4ch7A	1	0.8889	100	0.159	Contact Map
4un1A	1	0.9281	100	0.187	Contact Map
2e1cA	1	0.9608	100	0.19	Contact Map
4pcqA	2	0.9608	100	0.203	Contact Map
4un1B	1	0.9739	100	0.204	Contact Map
2p5vA	5	0.9869	100	0.209	Contact Map
3i4pA	5	0.9477	100	0.229	Contact Map
2pn6A	5	0.9542	100	0.234	Contact Map
2ia0A	2	0.9346	100	0.236	Contact Map
2cg4A	6	0.9608	100	0.247	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.007 seconds.