Q97W64 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97W64 - Uncharacterized protein

UniProt:	Q97W64	Sequences: MIILFITVEDEKLEVVKKVIGKLEQFTDTKIIYDERTKTFNILPKGQNQYETLKAVSVIRAIGLGFDEQSAFRLLSDEYTLDVIDLKALIGSNPDTIRRVKGRIIGENGKTKRIIQEYTGVDISIYGHYIGVLGPYDQVQIAKKAIELLIDGKEHSSVYKFLDKAEKDLIIYKTSKLRRKGISEIKDNG	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	189 (167)
Sequences:	381 (229)
Seq/√Len:	17.7

HALSA - Q9HN69
SULSO - Q97W64

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
23_L	31_I	4.784	1.00
111_T	159_Y	4.550	1.00
21_G	25_Q	3.932	1.00
16_V	59_I	3.449	1.00
8_V	63_G	3.175	0.99
115_I	142_A	2.912	0.99
119_T	123_I	2.908	0.99
105_I	125_I	2.707	0.98
20_I	33_Y	2.662	0.97
80_T	110_K	2.451	0.96
77_D	112_K	2.250	0.93
86_L	104_I	2.111	0.90
36_R	40_F	2.058	0.89
49_Q	162_L	1.976	0.87
140_Q	144_K	1.960	0.87
23_L	55_A	1.954	0.87
87_K	104_I	1.944	0.86
8_V	16_V	1.912	0.85
165_A	168_D	1.911	0.85
64_L	127_G	1.815	0.82
82_D	143_K	1.795	0.81
96_T	99_R	1.753	0.80
104_I	125_I	1.728	0.79
154_E	157_S	1.722	0.79
116_Q	149_L	1.697	0.77
64_L	129_Y	1.605	0.73
111_T	114_I	1.600	0.73
13_L	38_K	1.464	0.66
11_E	126_Y	1.456	0.66
87_K	130_I	1.450	0.65
136_Y	140_Q	1.397	0.62
27_T	55_A	1.394	0.62
8_V	13_L	1.390	0.62
15_V	62_I	1.381	0.61
74_L	159_Y	1.379	0.61
59_I	110_K	1.378	0.61
114_I	118_Y	1.369	0.61
67_D	125_I	1.363	0.60
67_D	70_S	1.356	0.60
9_E	63_G	1.350	0.60
104_I	146_I	1.293	0.56
72_F	110_K	1.288	0.56
70_S	73_R	1.283	0.56
28_D	46_G	1.282	0.56
59_I	132_V	1.270	0.55
104_I	130_I	1.265	0.55
35_E	38_K	1.251	0.54
78_E	160_K	1.242	0.53
132_V	142_A	1.222	0.52
27_T	75_L	1.208	0.51
18_K	69_Q	1.205	0.51
87_K	128_H	1.202	0.51
83_V	131_G	1.202	0.51
70_S	122_D	1.198	0.50
59_I	104_I	1.190	0.50
118_Y	166_E	1.183	0.50
32_I	142_A	1.182	0.49
113_R	125_I	1.181	0.49
83_V	146_I	1.171	0.49
15_V	126_Y	1.168	0.49
30_K	43_L	1.165	0.48
119_T	169_L	1.161	0.48
136_Y	166_E	1.157	0.48
22_K	32_I	1.120	0.46
104_I	149_L	1.119	0.46
58_V	75_L	1.113	0.45
69_Q	110_K	1.103	0.45
39_T	169_L	1.101	0.45
10_D	13_L	1.101	0.45
82_D	144_K	1.097	0.44
12_K	15_V	1.097	0.44
17_K	112_K	1.092	0.44
28_D	47_Q	1.090	0.44
40_F	74_L	1.087	0.44
130_I	146_I	1.085	0.44
17_K	20_I	1.081	0.43
89_L	146_I	1.078	0.43
102_G	107_E	1.060	0.42
68_E	112_K	1.038	0.41
148_L	161_F	1.031	0.40
25_Q	75_L	1.020	0.40
90_I	100_V	1.015	0.39
89_L	150_I	1.009	0.39
17_K	35_E	1.005	0.39
105_I	113_R	1.002	0.39
144_K	161_F	1.000	0.39
112_K	153_K	0.998	0.38
121_V	132_V	0.993	0.38
45_K	118_Y	0.979	0.37
31_I	47_Q	0.974	0.37
18_K	139_V	0.955	0.36
19_V	146_I	0.953	0.36
70_S	124_S	0.952	0.36
23_L	58_V	0.936	0.35
68_E	105_I	0.936	0.35
80_T	139_V	0.932	0.35
7_T	137_D	0.930	0.35
87_K	93_N	0.930	0.35
33_Y	144_K	0.927	0.34
154_E	160_K	0.918	0.34
108_N	159_Y	0.915	0.34
35_E	63_G	0.911	0.34
114_I	159_Y	0.909	0.33
101_K	126_Y	0.900	0.33
20_I	72_F	0.896	0.33
106_G	109_G	0.895	0.33
110_K	166_E	0.892	0.33
13_L	33_Y	0.889	0.32
58_V	89_L	0.884	0.32
33_Y	156_S	0.883	0.32
48_N	69_Q	0.878	0.32
127_G	138_Q	0.876	0.32
104_I	141_I	0.872	0.31
17_K	38_K	0.864	0.31
17_K	125_I	0.863	0.31
20_I	107_E	0.860	0.31
143_K	153_K	0.851	0.30
57_S	86_L	0.844	0.30
52_T	58_V	0.829	0.29
18_K	21_G	0.829	0.29
12_K	117_E	0.827	0.29
74_L	146_I	0.822	0.29
53_L	157_S	0.821	0.29
8_V	25_Q	0.819	0.29
108_N	125_I	0.815	0.29
29_T	120_G	0.807	0.28
18_K	169_L	0.802	0.28
33_Y	80_T	0.800	0.28
87_K	91_G	0.799	0.28
38_K	68_E	0.797	0.28
126_Y	131_G	0.794	0.28
42_I	130_I	0.789	0.27
36_R	145_A	0.784	0.27
28_D	169_L	0.779	0.27
81_L	169_L	0.778	0.27
42_I	143_K	0.771	0.26
153_K	156_S	0.767	0.26
36_R	127_G	0.767	0.26
29_T	118_Y	0.763	0.26
81_L	130_I	0.760	0.26
48_N	112_K	0.754	0.26
86_L	101_K	0.750	0.25
132_V	139_V	0.749	0.25
130_I	150_I	0.737	0.25
120_G	138_Q	0.737	0.25
23_L	167_K	0.735	0.25
32_I	88_A	0.733	0.25
113_R	136_Y	0.731	0.25
70_S	112_K	0.727	0.24
43_L	170_I	0.723	0.24
162_L	166_E	0.723	0.24
12_K	16_V	0.720	0.24
32_I	130_I	0.720	0.24
23_L	93_N	0.720	0.24
77_D	122_D	0.715	0.24
26_F	136_Y	0.714	0.24
127_G	162_L	0.711	0.24
16_V	71_A	0.709	0.24
48_N	162_L	0.704	0.23
20_I	167_K	0.699	0.23
76_S	139_V	0.697	0.23
142_A	146_I	0.695	0.23
96_T	150_I	0.691	0.23
8_V	11_E	0.690	0.23
5_F	29_T	0.683	0.22
103_R	106_G	0.682	0.22
8_V	69_Q	0.682	0.22
106_G	152_G	0.682	0.22
82_D	156_S	0.679	0.22
109_G	152_G	0.676	0.22
29_T	55_A	0.675	0.22
61_A	66_F	0.675	0.22
42_I	51_E	0.663	0.22
5_F	41_N	0.661	0.22
128_H	146_I	0.660	0.22
91_G	130_I	0.656	0.21
55_A	69_Q	0.654	0.21
105_I	118_Y	0.651	0.21
100_V	150_I	0.651	0.21
32_I	40_F	0.650	0.21
71_A	112_K	0.646	0.21
78_E	142_A	0.645	0.21
15_V	22_K	0.645	0.21
54_K	135_P	0.643	0.21
41_N	117_E	0.642	0.21
23_L	42_I	0.636	0.21
23_L	87_K	0.630	0.20
89_L	147_E	0.627	0.20
156_S	160_K	0.625	0.20
46_G	51_E	0.620	0.20
52_T	59_I	0.617	0.20
16_V	104_I	0.614	0.20
80_T	153_K	0.610	0.20
33_Y	162_L	0.607	0.19
51_E	110_K	0.605	0.19
60_R	98_R	0.604	0.19
57_S	85_D	0.604	0.19
8_V	169_L	0.603	0.19
12_K	48_N	0.601	0.19
57_S	100_V	0.600	0.19
103_R	134_G	0.595	0.19
28_D	119_T	0.594	0.19
47_Q	108_N	0.592	0.19
143_K	148_L	0.590	0.19
147_E	168_D	0.590	0.19
43_L	133_L	0.588	0.19
67_D	77_D	0.585	0.19
34_D	44_P	0.573	0.18
46_G	79_Y	0.570	0.18
62_I	68_E	0.569	0.18
82_D	88_A	0.567	0.18
124_S	131_G	0.565	0.18
51_E	162_L	0.565	0.18
85_D	129_Y	0.554	0.17
6_I	56_V	0.554	0.17
25_Q	91_G	0.552	0.17
45_K	91_G	0.551	0.17
14_E	17_K	0.551	0.17
33_Y	118_Y	0.548	0.17
103_R	109_G	0.548	0.17
9_E	16_V	0.547	0.17
29_T	58_V	0.546	0.17
11_E	115_I	0.541	0.17
162_L	170_I	0.537	0.17
34_D	58_V	0.536	0.17
40_F	63_G	0.536	0.17
24_E	83_V	0.533	0.17
73_R	84_I	0.528	0.17
37_T	88_A	0.527	0.17
67_D	124_S	0.525	0.16
25_Q	60_R	0.524	0.16
84_I	137_D	0.518	0.16
76_S	131_G	0.517	0.16
67_D	149_L	0.516	0.16
6_I	148_L	0.515	0.16
77_D	130_I	0.514	0.16
96_T	128_H	0.514	0.16
10_D	160_K	0.512	0.16
23_L	71_A	0.510	0.16
144_K	170_I	0.510	0.16
20_I	81_L	0.505	0.16
52_T	166_E	0.505	0.16
78_E	115_I	0.504	0.16
41_N	76_S	0.504	0.16
92_S	96_T	0.504	0.16
19_V	83_V	0.504	0.16
16_V	40_F	0.501	0.16
85_D	128_H	0.501	0.16
26_F	164_K	0.500	0.16
21_G	72_F	0.500	0.16

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4qmfD	1	0.8942	100	0.37	Contact Map
2e3uA	1	0.8466	100	0.461	Contact Map
1tuaA	1	0.9524	100	0.507	Contact Map
1j4wA	1	0.6508	99.1	0.815	Contact Map
2anrA	1	0.7037	99.1	0.816	Contact Map
3krmA	3	0.7196	99.1	0.818	Contact Map
2jvzA	1	0.746	99.1	0.818	Contact Map
2jzxA	1	0.7354	99	0.825	Contact Map
2qndA	2	0.6455	98.6	0.847	Contact Map
1k1gA	1	0.5132	98.2	0.863	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0074 seconds.